Property Summary

NCBI Gene PubMed Count 657
PubMed Score 64.58
PubTator Score 916.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Familial adenomatous polyposis 33 4.276 2.1
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Intestinal atresia 7 3.064 1.5

Expression

  Differential Expression (16)

Disease log2 FC p
glioblastoma -1.800 3.7e-04
astrocytic glioma 1.500 2.4e-02
oligodendroglioma 1.400 2.7e-02
psoriasis -1.300 1.8e-04
ependymoma -1.100 1.3e-07
group 3 medulloblastoma -1.700 6.4e-03
atypical teratoid / rhabdoid tumor -1.900 4.8e-06
medulloblastoma, large-cell -2.100 5.3e-05
primitive neuroectodermal tumor -1.300 1.7e-03
adrenocortical carcinoma 1.297 4.6e-04
colon cancer -1.200 5.3e-03
diabetes mellitus -1.100 1.5e-02
pediatric high grade glioma -1.500 2.8e-04
pilocytic astrocytoma -1.300 2.4e-05
Pick disease 1.600 3.9e-04
ovarian cancer 1.100 1.6e-02

Protein-protein Interaction (4)

Gene RIF (585)

PMID Text
26884349 Studied promoter methylation of ITF2 and APC and associated microsatellite instability in two case-case studies nested in colorectal cancer.
26681652 shows that RAR-beta methylation detected in lung tissue may be used as a predictive marker for non-small cell lung cancer diagnosis and that APC methylation in tumor sample may be a useful marker
26658612 Full-length APC promotes assembly of the Miro-1/Milton-2 complex.
26650777 As depicted in Figure 3, APC (25%) followed by KRAS (20%), TP53 (14%), and PIK3CA (11%) were the most frequently mutated genes.
26625971 two novel mutations in APC gene identified in Chinese families with familial adenomatous polyposis.
26613750 in 25% (5/20) of patients with colorectal adenomatous polyposis, somatic mosaicism of a pathogenic APC mutation was identified as underlying cause of the disease; data indicate a high prevalence of pathogenic mosaic APC mutations below the detection thresholds of routine diagnostics in adenomatous polyposis
26556314 While binding to gamma-tubulin may help target APC to the site of microtubule nucleation complexes, additional C-terminal sequences of APC are required to stimulate and stabilize microtubule growth.
26511139 Expression of APC is decreased in mutation negative cases and this appears to be a promising indicator of FAP predisposition, while for MUTYH gene, mutation is associated to reduced mRNA expression.
26447891 mutations are rare in Taiwanese patients with oral squamous cell carcinoma in Taiwanese patients
26446593 Our data represent the first comprehensive study delineating the mutation spectra of both APC and MUTYH in Hungarian familial adenomatous polyposis families
26436499 A male-specific association of the APC rs383830 polymorphism with coronary heart disease in the Chinese population has been found.
26421687 the findings that were derived from this large study cohort suggest that the I1307K variant in the APC gene is a global risk factor for cancer, with an OR of over 2.5, and mostly in males.
26393419 GSK3 acts through APC motifs R2 and B to regulate APC:Axin interactions, promoting high-throughput of betacatenin to destruction.
26320184 Suggest that the early activation of Hsf1 dependent cell stress pathway by mono-allelic mutations in APC can affect cell programming in a way that contributes to cancer onset.
26314409 APC I1307K variant was associated with an increased risk of colorectal cancer among Egyptian subjects.
26311738 analysis of the causative APC gene defects associated with familial adenomatous coli in a Chinese pedigree
26309368 APC c.3956delC mutation is a strong candidate biomarker of familial adenomatous polyposis in families of northern Brazil.
26252100 Deletion mutations of APC gene is associated with with familial adenomatous polyposis in Chinese family.
26246425 Elevated levels of putrescine and linolenate in Apc(Min/+) mice were significantly decreased by BRBs. Ornithine decarboxylase expression, the key enzyme in putrescine generation, was fully suppressed by BRBs
26179480 Meta-analysis shows there is an increased risk for desmoid tumors in individuals with APC mutations between codons 543-713 and 1310-2011 when compared to a reference population.
26073472 APC promoter methylation was found in 83.6% of stomach cancer patients but not controls. It correlated positively with tumor markers but negatively with survival.
26049416 APC loss-of-function significantly increases resistance to cisplatin-mediated apoptosis in both MDA-MB-157 and the PyMT derived cells.
25908636 expression and promoter methylation status in colon adenocarcinoma
25853848 APC promoter methylation is associated with the risk of hepatocellular carcinoma.
25751801 Desmoid disease occurs in patients who have familial adenomatous polyposis with almost any APC mutation, although there is an increased propensity in those with a 3' mutation
25738352 The increased expression of DNMT1, and the reduced expression of GSTP1 and APC have an important role in the development of prostate cancer .
25684670 Methylated APC and RARbeta2 genes might be valuable serum-based molecular markers for early detection of breast cancer.
25676610 we describe an extended consanguineous CLS family in which we map the disease to a novel locus that harbours a splicing mutation in APC, implicating APC for the first time in the pathogenesis of this syndrome.
25604157 detection of pathogenic APC variants in 7% of the patients, including mosaics, illustrates the usefulness of a complete APC gene reanalysis of previously tested patients, by a supplementary scanning method
25578398 The initiation of epithelial-derived tumors as a result of APC mutation or gene silencing may be driven by loss of polarity and dysmorphogenesis.
25514805 Hypermethylation of APC was associated with esophageal squamous cell carcinoma.
25449083 A novel heterozygous nonsense mutation c.2891T>G (L964X) of the APC gene was associated with a familial adenomatous polyposis.
25417611 our results showed that promoter methylation of cyclin-dependent kinase inhibitor 2A and adenomatous polyposis coli genes has a significant correlation with gastrointestinal cancer tissues.
25250560 Novel alterations in APC gene, within its exon 15 were found to be highly associated with colorectal cancer patients in African Americans.
25243319 A founder mutation within the APC promoter is associated with familial adenomatous polyposis in the United States.
25210923 Losses of a CNV at 5q22, especially in the DNA region surrounding APC-exon 9, may be associated with a higher risk of gastric cancer.
25183641 Different APC mutations were detected in these five Sicilian families, confirming the remarkable heterogeneity of the mutational spectrum in familial adenomatous polyposis.
25150829 Data indicate that expression of N-terminal adenomatous polyposis coli (APC) gene fragments cause primary cilia defects.
25107489 Aberrant methylation of APC gene was statistically significant associated with age over 50, DDK3 with male, SFRP4, WIF1, and WNT5a with increasing tumor stage SFRP4 and WIF1 with tumor differentiation and SFRP2 and SFRP5 with histological type
25025473 analysis reveals that the -286 SNP mutations of CRP tend to co-occur with mutated APC particularly in rectal cancer
24946964 Promoter-specific alterations in APC are a rare cause for mutation-negative familial adenomatous polyposis.
24861525 APC, KRAS, and TP53 gene mutations were more common in colorectal cancer than in stomach cancer
24747657 DNA methylation of GSTP1, APC and/or RASSF1 in initial, histopathologically cancer negative biopsies serves as a significant independent predictor of the presence of unsampled PCa.
24735542 this study reports a de novo germline mutation of APC as the causal variant in a Chinese family with inheritable colon cancer by the next generation sequencing.
24722208 In adenomatous polyposis coli, beta-catenin phosphorylation involves Axin and the 20 amino acids of APC or APCL.
24715170 Pin1 regulates the activation of Wnt/beta-catenin pathway in squamous cell carcinoma via modulating the interaction between beta-catenin and APC.
24667635 RIP140 stimulated APC transcription and inhibited beta-catenin activation and target gene expression.
24664543 molecular mechanisms underlying nuclear beta-catenin accumulation in fibro-osseous lesions of the craniofacial skeleton is unlikely to be mediated by CTNNB1 exon 3 or APC exon 15 mutations in most cases.
24664542 We identified two novel mutations at APC codon 1309 in two Chinese families suffering from Familial adenomatous polyposis
24599579 A French consortium of APC mutation screening has progressively improved the description of the variation spectrumand delineated phenotypic characteristics of the disease. The current version of the UMD-APC database is described here.
24590585 APC alterations are frequently involved in the pathogenesis of pancreatic acinar cell carcinomas
24549056 A novel APC germline mutation associated with an attenuated form of familial adenomatous polyposis that manifests as autosomal dominant late-onset colorectal cancer which is not easily identified with current risk stratification strategies.
24496450 Truncated APC still sustains a surprisingly high phosphorylation activity, which requires the protein to bind to CTNNB1 through the APC 20-amino-acid repeats, thus providing a biochemical explanation for the precise truncations found in cancer cells.
24444033 targeted directly by MSI1
24416237 Colorectal tumors from APC*I1307K carriers principally harbor somatic APC mutations outside the A8 tract
24390805 Mutations in the APC gene are an early event in colorectal tumorigenesis.
24320611 APC loss acts in tandem with Pik3ca mutation to drive the progression of gastrointestinal cancer.
24309598 APC gene mutation is associated with medulloblastoma, low-grade fibromyxoid sarcoma in a patient with Turcot syndrome.
24296361 This study demonistrated by Gene expression profile that APC upregulaion in fibroblasts of Huntington's disease patients.
24197976 The methylated pattern of APC promoter 1A was detected in 43.8% of gastric adenocarcinoma cases and correlated with T-stage (P = 0.046) and distant metastasis
24139208 Our observations support the involvement of somatic adenomatous polyposis coli alterations in tumorigenesis of ileal enterochromaffin cell neuroendocrine neoplasms
24130866 The study characterises the Mutation Cluster Region in APC (APC-MCR) as intrinsically disordered and proposes a model how this structural feature may contribute to regulation of Wnt signalling by phosphorylation.
24078348 Study demonstrated significantly increased APC rs11954856 and rs351771 SNP frequencies in Polish women with ovarian cancer.
24005794 Mutations in Adenomatous Polyposis Coli Protein is associated with colon cancer
23983135 No associations were found with CRC harboring G>T mutations in KRAS/APC.
23970361 There was no statistical significance between the APC germline mutations identified and the clinical variables considered in our study.
23896379 The APC p.I1307K gene variant is an important risk factor for colorectal neoplasia in average risk Ashkenazi Jews.
23874531 Methylation of APC and GSTP1 in non-neoplastic tissue adjacent to prostate tumour and mortality from prostate cancer.
23873622 in a family with familial adenomatous polyposis (FAP) history and the related colorectal tumor sample of the proband,new germline mutation identified in APC gene (exon 15): a heterozygous G deletion at position c.2126 resulting in a premature stop codon (p.Gly721GlufsX6) and truncated protein;mutation was also identified in the tumor tissue
23871111 The role of APCin facilitating the translocation of STIM1 puncta to ER-PM junctionsupon ER depletion.
23846443 These data suggest that the APC*E1317Q missense mutation may not be pathologically significant in the development of colorectal tumors.
23840886 APCL uses the 15 amino acid repeats region of APC to target beta-catenin for degradation.
23796566 By targeting APC, miR-155 efficiently regulates the Wnt/beta-catenin signaling
23773491 study demonstrated the APC gene mutation rate of colorectal cancer (CRC) in Taiwan was lower than other countries; inactivation of APC gene in CRC was not only due to gene mutation but also correlated with miR-21 upregulation
23725351 We suggest that there is a significant possibility that APC promoter 1B mutations could be found in mutation-negative FAP patients.
23646120 tissue-dependent consequences of Apc inactivation on proliferation and differentiation of ciliated cell progenitors by coordinating Wnt and Notch signaling.
23561487 This first comprehensive investigation of the APC and MUTYH mutation spectrum in Brazilian polyposis patients showed a high detection rate and identified novel pathogenic mutations
23555190 Benzo[a]pyrene, enhances APC-mediated accumulation of abasic DNA lesions, which is cytotoxic and mutagenic in nature, leading to enhanced neoplastic transformation.
23525311 The expression levels of CTNNB1, AXIN1 and APC did not correlate with the beta-catenin mutation status, which corroborates previous gene expression micro-array analyses
23504555 study evaluates the methylation patternsof the promoter regions of APC, p15INK4B, and p16INK4A in gastric cancer patients from Northern Brazil
23469016 show that the Gas2l3 protein is targeted for ubiquitin-mediated proteolysis by the APC/C(Cdh1) complex, but not by the APC/C(Cdc20) complex, and is phosphorylated by Cdk1 in mitosis
23405266 Single nucleotide polymorphisms in APC gene is associated with colorectal cancer.
23393221 CDX2 activated APC and AXIN2 promoter activities via intestinal cell-specific enhancer elements; results suggest that a low CDX2 level has influence on the Wnt signaling in invasive colon cancer cells possibly promoting cellular migration
23382461 These results point to APC as a crucial regulator of intermediate filament organization.
23334997 Results suggest that females have a higher risk of desmoid tumour independent of site, where as in males the risk is site specific.
23326336 Data indicate that the temperatures relative to the melting status (from 74 degrees C to 80 degrees C for APC gene and from 76 degrees C to 84 degrees C for CDKN2A gene.
23302090 Membrane protrusions with APC/beta-catenin-containing puncta control the migratory potential and mesenchymal morphology of mammary tumor cells.
23299921 A strong association between APC promoter methylation and prostate cancer. [Review]
23291410 Identification of a novel insertion mutation as the pathogenic gene of familial adenomatous polyposis in Chinese population, which could enrich the germline mutation spectrum of APC gene.
23277359 HectD1 promotes the APC-Axin interaction to negatively regulate Wnt signaling.
23244118 Exon 4 mutation in APC gene is associated with colon cancer.
23159591 Mayo Clinic APC testing experience during a 4-year period; study reports a large number of novel and known variants in APC, along with evidence of probability of their pathogenicity; relatively low mutation rate in the testing series suggests most patients with low numbers of adenomatous polyps do not have an APC gene mutation
23159080 Wnt5a, APC and beta-catenin genes might be involved in the carcinogenesis and development of colorectal adenocarcinoma. It is hypothesized that down-regulation of APC and Wnt5a proteins may be one of causes of ectopic expression of beta-catenin in CRC.
23131390 At multivariate analysis Apc and Fhit expression were independent predictors for gastric cancer specific survival.
23087084 results suggest that miR-106b plays an important role in promoting the proliferation of human hepatoma cells and presents a novel mechanism of micro RNA-mediated direct suppression of APC expression in cancer cells
23085758 APC genotypes in sporadic colorectal cancers show fine-tuned interdependence of hits by type/location, suggesting selection for particular residual levels of WNT/beta-catenin signalling with different optimal thresholds for proximal & distal cancers.
23055343 The aim of this study was to assess the extent of methylation of the RASSF1A and APC TSG promoters in ovarian epithelial cancers
23011394 APC is integral to pulmonary artery endothelial cell adhesion and survival.
22987206 30 germline variants were identified among 36 unrelated probands including large deletions.
22976915 Both MUTYH and APC genes are implicated in attenuated familial adenomatous polyposis, though the role of MutY homologue is of considerably greater relevance.
22907428 Our results therefore establish a novel miR-193a-5p-YY1-APC axis, which contributes to endometrioid endometrial carcinoma
22898821 the Amer2-EB1-APC complex regulates cell migration by altering microtubule stability.
22893084 We describe a child with epiretinal membrane and characteristic retinal pigment epithelial lesions that led to detection of an APC mutation and at-risk status for Familial adenomatous polyposis. .
22886683 Multiple jejunal cancers result from combination of germline APC and MLH1 mutations
22884971 Data support previous findings of APC regulating bone mineral density and demonstrate that a novel copy number variations of the APC gene is significantly associated with bone mineral density in Caucasian men and women.
22864938 Dietary, lifestyle and clinicopathological factors are associated with APC mutations and promoter methylation in colorectal cancers.
22851115 Among patients with multiple colorectal adenomas, pathogenic APC and MUTYH mutation prevalence varied considerably by adenoma count, including within those with a classic polyposis phenotype.
22825279 A case of familial adenomatous polyposis in which neonatal and maternal cytomolecular analysis revealed APC gene disruption at 5q22.2.
22796397 The results suggest that APC polymorphisms might be associated with CRC in the Chinese Han population.
22795047 The APC gene may be one of the susceptibility genes for major depression disorders as well as a genetic link between psychiatric disease and cancer
22787431 These studies demonstrate a novel role for APC in the suppression of Fen1 activity in the BER pathway
22761442 K63-linked polyubiquitin adducts on APC regulate the assembly and/or efficiency of the beta-catenin destruction complex.
22741528 Hypermethylation of APC promoter may play a role in the development and progression of gastric adenomas contributing to moderate activation of Wnt signaling.
22740476 Found the unique expression of the Wnt antagonist DKK4 in SW480APC, but not parental SW480 cell-derived exosomes. Upregulation of DKK4 in SW480APC cells was confirmed by RT-PCR, immunoblotting, and immunogold electron microscopy.
22719865 found and validated significant APC-dependent changes in chromatin modifiers Set-a and Rbbp7. Both were decreased on chromatin in APC-depleted extract; in addition, the kinetics of association of Set-a with chromatin was altered in the absence of APC
22704062 Trends in the expression of adenomatous polyposis coli protein suggests its involvement in oral carcinogenesis via Wnt pathway dysregulation.
22669205 In 76 patients with colorectal neoplasms, 9 missense mutations were identified in APC. 7 patients has multiple mutations, KRAS and APC, APC and APC, MLH1 and APC.
22528324 A single nucleotide polymorphism of the APC gene was significantly associated with recurrence risk in chemotherapy-treated patients with colorectal cancer
22509309 truncated APC is an essential component of colorectal cancer cells, required for cell proliferation, possibly by adjusting beta-catenin signalling to the "just right" level
22496417 The Smad7-APC complex links the TGFbeta type I receptor to the microtubule system to regulate directed cellular extension and migratory responses evoked by TGFbeta.
22469663 A discrete trimeric complex of beta-catenin, alpha-catenin and the tumor suppressor APC, forms in the cytoplasm in response to Wnt signaling.
22434720 Data suggest that hDlg may serve as a platform to bring in proximity APC and PTEN tumor suppressor activities.
22431159 Deep intronic APC mutations explain a substantial proportion of patients with familial or early-onset adenomatous polyposis.
22380946 findings suggest that APC mutation causes changes in energetic metabolite pathways and that these alterations might be involved in the development of colorectal cancer
22372443 a significant proportion of pediatric patients harbored germline mutations in APC
22324744 A total of 80.8% of Chinese patients with colorectal cancer show variations in microsatellite DNA, p53, APC or K-ras.
22294772 Mutations in APC is associated with stability of APC gene sequences and DNA repair and leads to colorectal carcinogenesis.
22277732 Increased plasma levels of the APC-interacting protein MAPRE1, LRG1, and IGFBP2 precede a diagnosis of colorectal cancer in women
22262720 APC gene deletion is associated with gastric adenocarcinomas.
22184111 APC regulation of GSK-3 also provides a novel mechanism for Wnt regulation of multiple downstream effectors, including beta-catenin and mTOR.
22103048 Adenomatous polyposis is caused by autosomal dominantly inherited mutations in the APC (Adenomatous polyposis coli) gene, a tumour suppressor gene that controls beta-catenin turnover in the Wnt pathway.
22081130 nuclear activation of beta-catenin is a late event in the tumorigenesis of nephroblastomas coinciding in some tumours with LOH of the APC gene.
22077694 GSTP and APC DNA methylation biomarkers in the setting of repeat biopsy in men with an initially negative prostate biopsy but a high index of suspicion for missed prostate cancer
22073196 methylation of the sense strand of APC occurred in 40% of HCCs from patients with serum AFP levels less than 20 ng/mL, suggesting a potential role for APC as a biomarker to complement AFP in HCC screening
22012588 DP1, but not DP2, is uniquely involved in the regulation of the p53 and p21Waf1/Cip1 pathway, thereby augmenting senescence in human somatic cells.
22000517 The armadillo domain of APC forms a superhelix with a positively charged groove. The tyrosine-rich domain of Sam68 is bound in a bent conformation to the APC groove.
21995949 Patients with colorectal cancer have a larger variance in germline levels of allele-specific expression in APC than controls; large distances from the mean ASE were associated with risk for common forms of CRC.
21949247 active Wnt/beta-catenin signaling is required for maintenance of colorectal tumor xenografts harboring APC mutations
21948542 The methylation rates of APC among free DNA in peripheral blood in patients with esophageal squamous cell carcinoma reflect tumor progression, and decrease with the solid tumour resection.
21915313 Data indicate that APC is required for appropriate axon morphological development and that the N-terminus of APC is important for regulation of the neuronal cytoskeleton.
21909382 The level of APC activity was proportional to the level of induced readthrough.
21904137 a positive family history for desmoid tumors, abdominal surgery, and APC mutation site are significant risk factors for development of desmoid tumors in familial adenomatous polyposis patients
21902576 7 changes were found in exon 15 of the APC gene in patients and in one of the ALL cell lines, Molt4.
21901162 In sporadic colorectal tumourspatients, the most frequently mutated gene was APC (68.9% of tumours), followed by KRAS (31.1%), TP53 (27.2%), BRAF (8.7%) and CTNNB1 (1.9%).
21900494 the tumor suppressor adenomatous polyposis coli controls microtubule targeting to the cell base to drive apical extrusion during cell death
21871439 APC-armadillo repeat domain (ARM) domain possesses a limited intrinsic flexibility, which might be an inherent property of ARM domains in general.
21865138 APC and KRAS mutations in distal colorectal polyps are related to smoking habits in men.
21859464 Several mechanisms by which cancer-related missense mutations in the large disordered domain of APC may interfere with tumor suppressor activity.
21858148 Results provide new insights into the binding mode of a defined C-terminal segment of APC by the PDZ domains of DLG1.
21857949 Results suggest implication for preventing or retarding the onset of colon cancer in people with inherited or acquired mutation of one APC allele.
21807601 the study confirms the role of epigenetic gene silencing of the pivotal molecular gladiator, APC, of the Wnt pathway in the development of CRC in the Kashmiri population.
21788986 The crystal structure of the PreARM-ARM domain of human APC is complexed with the ABR-SH3 domains of human Asef.
21779980 novel mutations associated with familial adenomatous polyposis identified. mutations observed reinforce importance of a wide array of diagnostic techniques, including RNA-based testing, cDNA sequencing and multiplex ligation-dependent probe amplification.
21737640 Authors report a strong inverse correlation between COX-2 and W-APC expression, with COX-2 being more frequently as expressed in LSCRC.
21680534 Methylated RARbeta(2) and APC genes might be valuable urinary molecular markers for early detection of bilharzial and nonbilharzial bladder cancer.
21665989 CtBP1 and CtBP2 promote the oligomerization of truncated APC through binding to the 15 amino acid repeats of truncated APC.
21664290 Adenomatous polyposis coli protein regulates the cellular response to DNA replication stress
21643010 Inactivation of promoter 1B of APC causes partial gene silencing: evidence for a significant role of the promoter in regulation and causative of familial adenomatous polyposis.
21598003 A pathogenic germline mutation in the adenomatous polyposis coli gene is associated with familial adenomatous polyposis
21573497 K-rasVal12 and mutant Apc have a synergistic role in intestinal neoplasms
21538028 Aberrant promoter methylation was investigated by methylation-specific real-time PCR for p16, p14, APC and hMLH1.
21484796 Our study indicates the close associations between AP1B, intestinal tumorigenesis and mutations in the APC gene.
21442240 Among 21 brain metastases analyzed, 58.8% of samples showed loss of heterozygosity of the adenomatous polyposis coli gene.
21404461 Increased expression of APC maybe an important marker for identifying endoderm cells differentiated from human embryonic stem cells.
21359685 APC gene deletions are associated with colorectal malignancies.
21315632 We report the clinical, radiological, and histopathological findings of this patient, who to our knowledge is the first reported case of a germinoma occurring in association with adenomatous polyposis.
21311754 The Cdc42-APC interaction induces localization of both APC and mutant APC and may thus play a direct role in the functions of these proteins.
21309064 Inactivation of Apc or forced activation of Wnt/beta-catenin signalling results in multiple supernumerary tooth formation in both humans and in mice.
21302450 Higher rates of the expressions of both APC and c-Myc proteins in non-small cell lung cancer primary foci were found compared with those in lymph node metastases.
21279955 analyzed association of genotype and haplotype status of 2 SNPs, rs2229992 and rs11283943, in the APC and MCC genes, respectively, with an increased risk of breast carcinogenesis in a breast cancer and control population from eastern India
21225915 Aberrant promoter methylation of adenomatosis polyposis coli gene is associated with germ cell tumors.
21207416 quantitative increase in promoter methylation levels of APC is associated with prostate cancer progression
21199875 APC as a key factor in MSI1 regulation through Wnt signaling and identify APC mRNA as a novel target of translational inhibition by MSI1.
21110124 APC gene mutations are associated with familial adenomatous polyposis.
21078161 Aberrant WNT/beta-catenin signaling by lost expression and DNA methylation of APC, and accumulation of active nonphosphorylated beta-catenin was observed in the analyzed Parathyroid carcinoma.
21057000 APC mutation-induced up-regulation of the survivin/ABK cascade can explain delayed crypt cell maturation, expansion of proliferative cell populations (including mitotic figures), and promotion of colon tumorigenesis.
20978327 EBV-positive gastric carcinomas revealed significantly more often gene hypermethylation of p16, p14 and APC.
20978149 Adrenocortical tumors (ATC) should be considered a familial adenomatous polyposis tumor. Biallelic APC inactivation mediates activation of the Wnt/beta-catenin pathway in the ACTs of patients with familial adenomatous polyposis.
20971552 We identify adenomatous polyposis coli (APC) as a binding partner of HBx and further determine that HBx competitively binds APC to displace beta-catenin from its degradation complex.
20935450 Novel germline mutation associated with familial adenomatous polyposis and malignant thyroid disease.
20924072 APC/MUTYH mutations were detected in 107 families
20924072 Observational study of gene-disease association. (HuGE Navigator)
20887112 This is the first reported case of spinal desmoid-type fibromatosis in association with adenomatous polyposis syndrome
20850014 Loss of the APC tumor suppressor gene causes upregulation of a DNA demethylase system; tissues taken from human subjects showed the demethylation of these same key developmental genes in human colon adenomas.
20844743 Observational study of gene-disease association. (HuGE Navigator)
20844082 a novel link between APC and hypoxia and show that APC and HIF-1alpha antagonize each other
20840677 Mutational analysis of APC genes in synovial sarcomas
20800603 Observational study of gene-disease association. (HuGE Navigator)
20723290 Triptolide can obviously suppress the proliferation of Jurkat cells, activate and up-regulate the expression of apc gene through demethylation.
20696900 deficiency in expression of PARK2 is significantly associated with adenomatous polyposis coli (APC) deficiency in colorectal cancer
20696710 The KIF17 participates in localizing adenomatous polyposis coli (APC) to the plus ends of a subset of microtubules.
20696638 APC DNA methylaton correlated with the presence of circulating tumor cells and disease prognosis.
20685668 the APC mutation spectrum from 15 years of systematic molecular screening which identified 863 independent alterations in the French population
20658693 Apc expression during lung development, injury, and repair.
20649969 Mutations in the APC gene is associated with familial adenomatous polyposis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20613673 Observational study of gene-disease association. (HuGE Navigator)
20570909 Observational study of gene-disease association. (HuGE Navigator)
20564245 Familial adenomatous polyposis patients display a significantly higher than normal mean bone mineral density compared with age- and sex-matched healthy controls in the presence of a balanced bone turnover.
20544848 APC mutations encompassing at least two beta-catenin down-regulating motifs are significantly more frequent in microsatellite unstable than in microsatellite stable colorectal cancers.
20519433 These results uncouple different APC functions and show that GSK3 beta/CKI phosphorylation regulates APC clusters and cell migration independently of cell-cell adhesion and beta-catenin transcriptional activity.
20513532 three novel mutations in a group of Korean FAP patients broadens the spectrum of APC mutations.
20510605 An association between genotypes for any of the eight APC SNPs and advanced distal adenoma risk was not observed, however, the risk for advanced distal adenoma was threefold higher for one rare haplotype.
20510605 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20473645 loss of APC is a frequent molecular event in atypical adenomas and carcinomas
20453000 Observational study of gene-disease association. (HuGE Navigator)
20437058 Observational study of genetic testing. (HuGE Navigator)
20434453 Adapted the single nucleotide primer extension methodology to perform a detailed allele-specific expression analysis of the APC gene in adenomatous polyposis families.
20371677 Hypermethylation of the APC and LINE-1 methylation is associated with non-small cell lung cancer.
20352275 Observational study of gene-disease association. (HuGE Navigator)
20333795 Report a variety of APC gene mutations in Chinese familial adenomatous polyposis patients, and mutation detection rates were relatively high.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20229069 higher frequency of LOH in rectal polyps from patients with codon 1309 mutations may help to explain their increased polyp burden at this site compared with patients who have other germline APC mutations
20208994 the promoter region is frequently hypermethylated in the APC and RASSF1A tumour suppressors in parathyroid tumours
20149637 Observational study of gene-disease association. (HuGE Navigator)
20092957 Allelic losses of the APC gene were present in three seminomas and one nonseminoma
20063100 FISH analysis revealed a structural loss of heterozygosity (LOH) in the APC gene on chromosomal locus 5q21 in one out of five analysed desmoids of the mother, no LOH of APC gene in the Gardner fibroma.
20056645 Two single nucleotide polymorphisms in the APC and NIN loci were significantly associated with pancreatic cancer risk
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20033212 Diagnosis of three attenuated FAP families due to a 1.4-kb deletion within intron 14 of APC.
20027139 APC polymorphism D1822V is potentially associated with the risk of colorectal cancer; Y486Y, T1493T and S1756S also seem to be associated with colon cancer risk. All these polymorphisms may be used as markers for diagnosis of colorectal cancer.
20007843 Observational study of genetic testing. (HuGE Navigator)
19966865 Data show that binding of beta-catenin to the 15R of APC is necessary and sufficient to target beta-catenin for degradation.
19945765 hypermethylation in tumors from non-small cell lung cancer patients is associated with gender and histologic type
19928354 This review summarizes our current understanding of the role of APC and Wnt signaling in the regulation of apoptosis, based upon studies from fly and mouse in vivo models, as well as cultured carcinoma cells.
19928352 Reviews the literature linking APC to regulation of mitotic fidelity and discusses the implications for dividing epithelial cells in the intestine.
19928349 This review focuses on APC localization and functions in the nucleus.
19928347 Introductory article about APC protein reviews.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19912361 Hypermethylation of APC promoter 1A, instead of mutations involving APC and beta-catenin, contributes to moderate activation of Wnt signalling in a subset of serrated adenomas.
19900451 amino-terminal segment of APC promotes cell sensitivity to apoptosis modulated through its binding to 40- and 43-kilodalton hTID-1 isoforms.
19900189 hypermethylation of APC promoter region is an early event in endometrial tumorigenesis.
19889076 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19888426 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19845967 APC associates with all three major components of the cytoskeleton, thus expanding potential roles for APC in the regulation of cytoskeletal integrity.
19793053 APC or MUTYH mutations were detected in 42/48 (88%), 14/20 (70%) and 10/38 (26%) of familial adenomatous polyposis, attenuated familial adenomatous polyposis and multiple colorectal adenomas patients, respectively.
19777185 single-nucleotide polymorphisms in the adenomatous polyposis coli gene are associated with prostate-specific antigen recurrence after radical prostatectomy in prostate cancer.
19777185 Observational study of gene-disease association. (HuGE Navigator)
19773381 Tumor-specific methylation of APC, MGMT, RASSF2A, and Wif-1 genes might be a valuable biomarker in plasma for the early detection of colorectal cancer.
19768578 Observational study of gene-disease association. (HuGE Navigator)
19728755 APC mutation at codon 1309 is associated with familial adenomatous polyposis.
19703905 cyclin A/cdk2-dependent phosphorylation of APC affects astral microtubule attachment to the cortical surface in mitosis
19701947 data support a novel mechanism in which p.Glu1317Gln in combination with other weak mutant APC alleles (generating polypepetides with zero, two, or three 20AARs) can provide the necessary growth advantage for colorectal tumorigenesis
19692168 Observational study of gene-disease association. (HuGE Navigator)
19679059 Mutations in adenomatous polyposis coli protein is associated with Colorectal Carcinoma.
19672874 High-throughput copy number and gene expression data of 36 microsatellite stable sporadic colon cancers resected from patients of a single institution characterized for mutations in APC, KRAS, TP53 and loss of 18q were analyzed.
19672874 Observational study of gene-disease association. (HuGE Navigator)
19654215 The middle region of APC is sufficient to recruit Nup358 to the plus ends of microtubules.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19617769 The E1573X mutation is the most distal mutation in the APC sequence reported to date as a mosaic and, interestingly, in the context of Gardner syndrome with extensive extracolonic features.
19615284 No statistically significant correlation was found between the methylation of APC gene and pathological complete response to neoadjuvant chemotherapy in primary breast cancer.
19606680 APC alternations appear to be early in GERD-BE-dysplasia-ADC sequence. The specific polymorphism may identify patients with high risk of progression into Barrett's Esophagus.
19606680 Observational study of gene-disease association. (HuGE Navigator)
19593690 At least two genes are associated with the FAP phenotype. APC mutations account for the majority of cases, while MUTYH mutations can be observed in 10% of patients.
19593690 Observational study of gene-disease association. (HuGE Navigator)
19584833 Hypermethylation of both p16 and APC strongly predicts progression to high-grade dysplasia or cancer in patients with Barrett's esophagus. Absence of p16 and APC hypermethylation is associated with a benign course.
19576224 Results suggest a role of COP9 signalosome (CSN)-mediated deneddylation in the formation of the beta-catenin-degrading supercomplex and the protection of complex-bound adenomatous polyposis coli via CSN-associated USP15.
19571702 Observational study of gene-disease association. (HuGE Navigator)
19543899 Alterations in TP53, APC, K-ras, and DCC genes in the non-dysplastic ulcerative colitis and Crohn's disease colon, were analyzed.
19543899 Observational study of gene-disease association. (HuGE Navigator)
19531215 A genotype-phenotype correlation was found for most of the APC identified mutations
19531215 Observational study of gene-disease association. (HuGE Navigator)
19527921 methylation of APC promoter 1A is a passenger, and suggested that marked down-regulation of 1B expression could be related to formation of a field predisposed to gastric cancers.
19527492 Observational study of gene-disease association. (HuGE Navigator)
19525225 Asef and APC function downstream of HGF and PI3-kinase, and play critical roles in growth factor-mediated regulation of cell morphology and migration
19515250 local influences over the rate of loss of heterozygosity at APC are not factors that explain inter-individual differences in susceptibility to colorectal cancer
19506903 Methylated state of this set of genes may be more specific to the late rather than the early stage of NSCLC.
19474113 The APC E1317Q variant is associated with colorectal neoplasia, particularly colorectal adenomas
19474113 Observational study of gene-disease association. (HuGE Navigator)
19470943 Promoter methylation in APC was identified as a marker for prostate cancer progression.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19450512 These findings suggest that, following APC loss, CtBP1 contributes to adenoma initiation as a first step, whereas KRAS activation and beta-catenin nuclear localization promote adenoma progression to carcinomas as a second step.
19448414 APC, E-cadherin, beta-catenin and cyclin D1 may play important roles in tumorigenesis of esophageal squamous cell carcinoma(ESCC).
19444466 APC mutations are associated with familial adenomatous polyposis.
19378335 we show that cells harboring APC mutations have low-level activated wnt signaling, which can be blocked by the extracellular wnt inhibitor DKK-1, suggesting autocrine activation of this pathway
19351817 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19337631 Observational study of gene-disease association. (HuGE Navigator)
19309276 Subjects presenting methylation in the APC promoter demonstrate significantly lower hazards for all causes of death (hazard ratios=0.378, p=0.011) or colorectal cancer deaths (hazard ratios=0.426, p=0.039).
19307944 APC mutations are associated with poor response to 5-fluorouracil adjuvant chemotherapy in Taiwanese colorectal cancer.
19307944 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19261806 An interaction of tumor-associated N-terminal APC fragments (N-APC) with Mad2, an essential mitotic checkpoint protein, providing a direct molecular support for linking APC mutations to the generation of chromosome instability, is reported.
19196998 6 rare APC variants in patients with familial adenomatous polyposis at the mRNA level; APC variants c.531 + 5G>C and c.532-8G>A in intron 4, c.1409-2_1409delAGG in intron 10, c.1548G>A in exon 11, and a large duplication of exons 10 and 11 and c.1742A>G.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19169759 Observational study of gene-disease association. (HuGE Navigator)
19164452 MLH1-hypermethylated colorectal tumors harbor fewer APC and KRAS mutations and more BRAF mutations, suggesting that they develop distinctly from an MGMT methylator pathway.
19124205 The mean values of the percentage of positive cells for APC between extra-abdominal desmoid tumor did not demonstrate any statistically significant difference
19111562 These research data identify APC mutation c.1918C>G (pR640G) as pathogenic and indicate a mechanism involving disruption of an ASF/SF2 exonic splicing enhancer element.
19110823 overview of the functions of Apc and examination of how this information can be used in the prognosis and development of directed therapy in colorectal cancer [review]
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19061640 The SCF(beta-TrCP) binding site created by phosphorylation of beta-catenin is highly vulnerable to protein phosphatase 2A (PP2A) and must be protected by the adenomatous polyposis coli (APC) tumor suppressor protein.
19036155 We present new APC mutations and specifically discuss two cases that demonstrate the broad phenotypic spectrum in familial adenomatous polyposis
19035518 demonstrate a novel association between APC functional status and mPGES-1 expression in colorectal tumor cells, being most likely related to reduced mPGES-1 mRNA degradation rate in the APC wild type state
19029688 Observational study of gene-disease association. (HuGE Navigator)
19026650 Observational study of genetic testing. (HuGE Navigator)
19013464 Observational study of gene-disease association. (HuGE Navigator)
18992635 Loss of heterozygosity is observed at the APC locus in 52% of sporadic colorectal tumors in this study.
18992635 Observational study of gene-disease association. (HuGE Navigator)
18992263 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18987576 Molecular diagnostics of Slovak familial Adenomatous Polyposis Coli families revealed broad palette of mutations in crucial APC gene
18982352 In a large Canadian Mennonite polyposis kindred, we identified a large novel germline deletion in the APC promoter region by linkage analysis and MLPA.
18977219 APC promoter 1A hypermethylation may influence APC expression levels in a subtle fashion, but methylation does not result in complete gene inactivation or act as a 'second hit'.
18955873 investigation of children presenting with apparently sporadic hepatoblastoma; no germline APC mutations were found
18854359 The CID domain of APC is required to down-regulate the transcriptional activity and the level of beta-catenin.
18847451 Promoter hypermethylation of the APC gene is related to a lower number of metastatic lymph nodes and to superior prognosis in terms of recurrence, suggesting it might be involved in lymphatic metastasis in esophageal neoplasms.
18844223 adenomatous polyposis coli gene and nuclear b-catenin may have roles in wnt-related progression of invasive urothelial carcinomas
18844223 Observational study of gene-disease association. (HuGE Navigator)
18841156 for the first time, we report the association of aberrant methylation of the APC gene promoter with the inflammatory breast cancer phenotype
18807072 No mutations were detected in adenomatous polyposis coli protein or beta-catenin in pulmonary artery sarcoma.
18774639 level of APC expression determined the type of TGFbeta function in these human colon carcinoma cells
18770064 Possibly, the homozygosity of the germ-line mutation of the APC*I1307K gene in this Ashkenazi patient contributed, along with the observed somatic beta-catenin gene mutation, to the development of the desmoid tumor.
18708403 The rs454886 snp in the APC tumor suppressor gene was associated with increased breast cancer risk.
18708403 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
18662849 Taken together with the transcriptional activation of APC gene by alkylating agents and modulation of BER activity, APC may play an important role in carcinogenesis and chemotherapy by determining whether cells with DNA damage survive or undergo apoptosis
18662704 Results show a correlation of CDH1 and APC promoter methylation with loss of E-cadherin and APC proteins and with activation of Wnt/beta-catenin signaling pathway.
18646694 There are somatic mutations of the APC and beta-catenin genes in aggressive fibromatosis.
18632987 APC has a role in the G2/M transition, potentially through association with topo IIalpha
18632876 APC promoter methylation and altered nuclear beta-catenin localization is associated with digestive endocrine tumours.
18632657 a germ-line allele sequence in the APC gene may have a role in risk of metachronous adenomatous polyps
18632633 the miR-135 family regulates APC in colorectal cancer
18630182 Observational study of gene-disease association. (HuGE Navigator)
18629513 A patient with CRC at age 16 was found to carry the APC c.3183_3187del5 mutation as well as the MSH2 mutation, and it is inferred that her father, deceased of CRC at age 24, was also a double heterozygote.
18617334 inactivation of the APC gene plays a minor role in the carcinogenesis of oral squamous cell carcinoma
18612690 Germline missense APC alterations observed in 33 percent of patients with multiple colorectal neoplasms seemed to play a limited role in colorectal cancer risk when independently assessed by a population-based, case-control analysis.
18612690 Observational study of gene-disease association. (HuGE Navigator)
18519734 APC has roles in chromosome instability [review]
18498351 Functional interaction between estrogen receptor(ER)s and APC shows that APC may physically associate with ER alpha in a ligand-dependent manner and enhance estrogen-dependent transactivation of the estrogen response element.
18486530 APC missense mutation may play an important role for the pathogenesis of epithelial odontogenic tumors
18485586 Our demonstration of placental methylation of the APC-1a promoter represents the first observation of monoallelic methylation of this gene in early development
18483325 Increasing parity was associated with decreased APC methylation.
18477604 Our data indicate that this newly identified regions in the N-terminal third of APC contributes to the regulation of APC clusters.
18474248 APC can negatively regulate cell cycle progression through inhibition of DNA replication by direct interaction with DNA
18454178 APC involves in the double-strand breaks DNA repair and that truncation mutations impair chromatin-associated functions of APC
18451217 study found in colorectal carcinoma, APC hypermethylation was age related & did not cluster with CpG island methylator phenotype; hypermethylation of APC concurrently with either MGMT or hMLH1 was associated with occurrence of G-to-A transitions in APC
18433509 Observational study of gene-disease association. (HuGE Navigator)
18418860 Tissue environment appears to influence the position of the 'second hit' in pouch polyps and the mutations resemble those of large bowel polyps.
18406876 Duplication in the APC gene is associated ith familial adenomatous polyposis.
18403596 There is a conserved signature of 166 genes that were differentially expressed between adenomas and normal intestinal mucosa with APC mutation.
18393246 APC gene germline mutations can cause the development of familial adenomatous poly.
18393237 The mutation rate of the APC gene in this group of Chinese FAP families was about 48.39%, and 4 novel mutations were detected. Frameshift mutation was the major mutation type in Chinese FAP and mainly located in exon 15.
18387968 Tumour-associated truncations of APC abolish the interaction with beta-catenin.
18384130 Mutations in APC are associated with melanoma
18375958 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18369740 results suggest that the inactivation of the APC gene is very common in sporadic colorectal cancer, and the main inactivation mechanism of the APC gene is promoter hypermethylation
18343606 Variants of this protein found in this study are not involved in the colorectal carcinogenic process.
18343606 Observational study of gene-disease association. (HuGE Navigator)
18337602 Methylation of the promoter region of the APC gene in patients with stage I NSCLC treated with curative intent by means of surgery is associated with early recurrence.
18321998 The result of approximately 10(-5) mutations per allele per year, although higher than previous estimates, appears to be consistent with the mutational spectrum of adenomatous polyposis coli.
18265644 The data support that the frequencies and patterns of somatic mutation othe APC gene in colorectal cancer are variable among different populations.
18224684 The number of beta-catenin downregulating 20-aa repeats in truncated APC gene associated with colorectal tumorigenesis is different in profuse, sparse and attenuated types of FAP, and is also different between colorectal and extracolonic tumors.
18199528 Observational study of gene-disease association. (HuGE Navigator)
18199528 multiple rare nonsynonymous variants in APC play a significant role in predisposing to colorectal adenomas.
18166348 Findings strongly support a pathogenic role of the APC N1026S variant in the AFAP phenotype.
18160396 cancer mutations induce APC mitochondrial localization and that APC regulation of Bcl-2 at mitochondria may contribute to tumor cell survival.
18091433 Observational study of gene-disease association. (HuGE Navigator)
18070451 APC gene methylation plays an important role in the carcinogenesis of cervical cells, and can re-express after treatment with Hydralazine.
18066497 genetic changes of APC gene play a role in meningioma formation.
18063416 Two large AFAP (attenuated form of familial adenomatous polyposis) kindreds with the identical APC disease-causing mutation (c.426_427delAT) were linked to a founding couple who came to America from England around 1630
18058812 No field effect, defined as absence of epigenetically transformed cells, for GSTP1 was observed, whereas APC, RARbeta2, and RASSF1A showed a field effect up to 3 mm from the malignant core in three prostatectomy samples.
18027849 investigate the possible role of germline hypermethylation of the APC promoter in FAP and AFAP families that were negative for APC and MUTYH mutations
18026870 The researchers describe a family with de novo mutations of the mosaic form in a family with familial adenomatous polyposis.
17973119 Promoter methylation of the APC gene seems to be of significance in hepatocarcinogenesis
17968317 binding per se of beta-catenin by adenomatous polyposis coli does not require phosphorylation by GSK-3beta
17964080 Analyzed the phenotype, DNA ploidy patterns, and microsatellite regions linked to APC gene on chromosome 5q of low-grade gastric adenomas/dysplasias, Vienna Category 3, to investigate whether these lesions have the potential to become adenocarcinomas.
17963004 study detected 17 different truncating mutations APC in 21 of 24 Chilean familial adenomatous polyposis families; 9 of these were novel
17960617 Promoter hypermethylation of APC is associated with prostate cancer progression
17954272 Two cancer-free dysmorphic patients with karyotypes that confer susceptibility to familial Adenomatous polyposis and von-Hippel-Lindau syndrome.
17952864 Desmoid tumors occurring in the background of familial adenomatous polyposis (FAP) usually contain inactivating germline mutations in the adenomatous polyposis coli (APC) gene.
17947477 hypermethylation of APC has a role in progression of prostate neoplasms
17927853 The positive rate of APC was significantly lower in colorectal carcinoma and colorectal adenoma with malignancy than in colorectal adenoma and normal colorectal mucosa.
17920230 Observational study of genotype prevalence. (HuGE Navigator)
17920230 the E1317Q gene variant in the APC gene is not found in cancers outside of the colon
17910481 Chemical dissection of APC repeat 3 multistep phosphorylation by the concerted action of protein kinases CKI and GSK3.
17905526 This paper focuses on changes in E-cadherin (CDH1), adenomatous polyposis coli (APC), and beta-catenin (CTNNB1) in 50 tumors of the central nervous system.
17882487 We identified two novel mutations: 1018T>C and 1309delGAAAA. This study helps in defining new biomarkers for the early diagnosis of Turkish patients with familial adenomatous polyposis.
17854661 Observational study of gene-disease association. (HuGE Navigator)
17854661 Adenomatous polyposis coli gene variant is associated with colorectal cancer
17704924 Report genetic alterations of APC in Korean colorectal cancer patients.
17665205 FAP is associated with germline mutation in the APC gene inherited in an autosomal dominant manner.
17653897 A nonsense mutation in Arg1114X in the APC gene was found in 5 of 43 colorectal cancer patients. The patients also had higher rates of metastasis.
17620292 The APC tumor suppressor mutation was ssessed in the ability of apigenin in induce cell cycle arrest in HT29-APC cells.
17572842 APC is highly expressed in the intestinal and colorectal epithelia and it is involved in homeostasis of the enterocyte renewal phenomena, in which proliferation, migration, differentiation, and apoptosis are highly regulated both temporally and spatially
17569124 Familial adenomas polyp is caused by mutations in the APC tumor suppressor gene.
17562262 Abnormal methylation of APC gene occurs in the progression of breast cancer, which is the main cause for the absence of APC protein expression, and the major mechanism of inactivation of APC gene.
17562260 APC gene is hypermethylated in HCI-H460 cells, and its transcription coud be activated by 5-aza-dC.
17558858 there are somatic mutations of APC & beta-catenin genes in desmoid-type fibromatosis & abnormalities in Wnt signal pathway; these abnormalities may result in aberrant cell proliferation & apoptosis, which may be important in tumorigenesis & progression
17556698 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17556698 results suggest a significant interaction between the D1822V APC polymorphism and the dietary intakes of cholesterol, calcium, and fiber for colorectal cancer risk
17506007 identified a novel frameshift mutation at exon 15, corresponding to codon 12
17505512 Hypermutation of APC does not cause multiple colorectal adenoma.
17489848 Observational study of genotype prevalence. (HuGE Navigator)
17489848 the presence of germline mutations in the adenomatous polyposis coli (APC) genes in attenuated familial adenomatous polyposis.
17486639 APC mosaicism is a frequent cause of familial adenomatous polyposis
17454753 racial factor may not be related to the occurrence of mismatch repair defects and APC mutations in our multi-racial patient cohort.
17437043 APC protein and GSK3beta may synergistically play an important role in the repair of airway epithelial cells.
17418091 The retained beta-catenin in cytoplasm by APC may be down-regulated by Axin 2, which is induced by beta-catenin/Tcf signaling.
17411426 Observational study of genotype prevalence. (HuGE Navigator)
17411426 both novel and reported APC mutations were identified in Czech and Slovak FAP patients
17410430 G-->T transversion caused a splice site mutation which resulted in deletion of exon 4 of the APC gene in a family with attenuated familial adenomatous polyposis
17368237 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17360132 examined the apc 5' coding region and identified nine new transcripts generated from alternative and/or aberrant splicing
17297457 Results demonstrate that cleavage of APC and the subsequent release of an amino-terminal segment are necessary for the transcription-independent mechanism of APC-mediated apoptosis.
17255093 in motile cells beta-catenin is recruited by IQGAP1 and N-cadherin to active membrane ruffles, wherein beta-catenin mediates the internalization and possible recycling of the membrane-associated proteins N-cadherin and APC
17252231 Observational study of gene-disease association. (HuGE Navigator)
17227893 Loss of APC immediately induces chromosomal instability as a result of a combination of mitotic and apoptotic defects, which may amplify each other to increase the incidence of tetra- and polyploidy in early stages of tumorigenesis.
17222366 The aberrant APC gene methylation in peripheral serum of breast cancer patients is significantly correlated to that in primary tumor.
17221838 Observational study of gene-disease association. (HuGE Navigator)
17221838 The genomic locus at APC is associated with autism spectrum disorder.
17192415 These data demonstrate that cell migration and microtubule stability are linked to APC status.
17189293 Truncated APC regulates the transcriptional activity of beta-catenin in a cell cycle dependent manner.
17176113 APC interacts with Fen-1 to inhibit its activity, thus providing a second mechanism for blocking strand-displacement synthesis of long-patch base excision repair.
17143620 These results support the notion that in attenuated polyposis patients, a detailed investigation of APC transcription can allow detection of rare alterations.
17143298 APC mutations have roles in adenoma formation as well as tumour progression to invasive malignancy [review]
17135276 Most desmoids with two APC hits (87%, 26/30) had one mutated allele with no 20-amino acid repeats (P < 0.001).
17126424 60S APC is a discrete high molecular weight complex with a novel function in cytoskeletal regulation in epithelial cells.
17119068 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17119068 APC E1317Q is not shown to be associated with a clinically meaningful risk of colorectal cancer
17116713 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17116713 Folate may enhances colorectal carcinogenesis through a distinct APC mutated pathway.
17080006 Observational study of gene-disease association. (HuGE Navigator)
17039269 We conclude that the high incidence of CRC in Newfoundland may be attributable to genetic, or at least familial, factors. In the high-risk families we provide evidence for the involvement of founder mutations in the APC and MSH2 genes.
17028196 role for APC in regulating degradation of the transcriptional co-repressor C-terminal-binding protein-1 (CtBP1) through a proteasome-dependent process
16981189 APC methylation was associated with wildtype BRAF (p = 0.003) and with lower concentrations of methyl group carriers (p < 0.05).
16951153 APC transgenic mice provide an alternative model to Apc mice to study familial adenomaatous polyposis and distal sporadic colorectal cancer.
16855398 genomic instability is an early event that occurs at precancerous stages prior to changes in tumor suppressor genes (p53 and APC) in Barrett's esophagus-associated tumorigenesis in patients
16843107 Observational study of gene-disease association. (HuGE Navigator)
16843107 These data indicate that somatic mutations affecting APC and CTNNB1 do not play a major role in the pathogenesis of sporadic ependymomas.
16820884 analysis of APC gene deletion in patients with familial adenomatous polyposis
16804979 Most adenomas expressed full-length APC protein, suggesting that protein expression is not a reliable marker for assessment of APC gene mutation.
16798748 APC regulates beta-catenin phosphorylation and ubiquitination by distinct domains and by separate molecular mechanisms
16763565 Impaired EB1 or APC function generates lesions invisible to the spindle checkpoint and thereby promotes low levels of chromosomal loss (CIN) expected to fuel aneuploidy and possibly tumorigenesis.
16753179 the central region of APC is unstructured in the absence of beta-catenin and Axin; beta-catenin may interact with each of the APC 15aa and 20aa repeats independently
16710723 case of the AAPC syndrome caused by a CCTT deletion at codon 173, with polyps diagnosed at the age of 17. The father and grandfather of the proband died of colorectal cancer (CRC), which developed from untreated polyps
16699861 The high frequency of methylation of the APC gene promoter suggests that the inactivation of tumor suppressor genes and of the genes related to the control of cellular proliferation through this mechanism is involved in gallbladder carcinogenesis.
16699180 Mutations in the APC gene resultt in impaired retinoic acid biosynthesis and upegulation of cyclooxygenase-2.
16680592 APC mutations are important in development of the cribiform-morula variant of papillary thyroid carcinoma(an extracolonic manifestations of familial adenomatous polyposis)occurring mostly in the 5' side of the APC gene between codons 308 and 935.
16650078 Novel mutations within the APC gene are associated with familial and sporadic adenomatous polyposis.
16619216 Hypermethylation of adenomatosis polyposis coli protein is associated with primary adenocarcinomas of the small bowel
16569251 Observational study of gene-disease association. (HuGE Navigator)
16545110 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16537703 Observational study of gene-disease association. (HuGE Navigator)
16525027 The association of endogenous APC with microtubule ends correlates directly with their increased growth stability, that this can occur independently of its association with EB1.
16461775 Attenuated familial adenomatous polyposis (AFAP) is associated with germline mutations in the 5', 3', and exon 9 of the adenomatous polyposis coli (APC) gene.
16450383 decrease of APC levels achieved by RNA interference impairs cell proliferation and DNA replication, not only in 293 cells that express a wild-type protein, but also in SW480 colon cancer cells that express exclusively a truncated APC fragment.
16433700 In this report, we analyze the first kindred clustering Familial adenomatous polyposis (FAP) and multiple gynecolgic tumors.
16426911 results of this study show that esophageal squamous cell carcinoma is associated with genetic instability, that is, allelic imbalance/loss of heterozygosity and microsatellite instability of the APC gene
16423286 the N-terminal region of the APC protein mediated its junctional localisation, consistent with the observation that truncated APC proteins in colon cancer cell lines are still capable of localising to the cell cortex
16411234 Observational study of gene-disease association. (HuGE Navigator)
16407829 Promoter methylation of APC was found in all Barrett esophagus samples & 95% of esophageal adenocarcinomas. Full methylation of APC correlated with lack of expression.
16382042 sulindac sulfone can modulate the APC/beta-catenin pathway in vitro but its efficacy is dependent upon the mutational status of APC and beta-catenin
16356174 Observational study of gene-disease association. (HuGE Navigator)
16356174 APC and K-ras, but not CTNNB1 mutations have roles in regulation of expression of hMLH1 in sporadic colorectal carcinomas
16329837 Wnt-1, beta-catenin and APC expressions were related to the differentiation of oral squamous cell carcinoma.
16322291 Hypermethylation of Adenomatous Polyposis Coli Protein is asspciated with prostate tumorigenesis
16228836 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16201232 Observational study of genetic testing. (HuGE Navigator)
16188939 the interaction of APC with microtubules and the beta-catenin-targeting complex are mutually exclusive, and indicate that the distribution of endogenous APC between different pools is dynamic, which allows cells to distribute it as required
16184469 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16184469 Finds several types of meat may contribute differently to the aetiology of colon and rectal cancer, depending on APC mutation status.
16163548 The cytoplasmic accumulation of beta-catenin is a common characteristic of oral SCC, but is not closely associated with mutational alterations in the APC, beta-catenin and Axin1 genes.
16142311 MUC5AC and MUC2, TFF1 and TFF3, APC and p21 in subsets of colorectal polyps and cancers suggests a distinct pathway of pathogenesis of mucinous carcinoma of the colorectum
16088911 APC gene mutational analysis in Korean families with familial adenomatous polyposis
16030254 APC regulates mitotic spindle function and how errors in chromosome segregation are tolerated in tumor cells.
15981102 No significant genetic alterations were found.
15959913 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15952110 Thirteen APC germline mutations were identified in 22 FAP patients. All of the mutations were nonsense or framshift mutations. FAP patients with mutations in the 5'or 3'extreme parts of the APC gene showed mild clinical symptoms.
15951963 Observational study of gene-environment interaction. (HuGE Navigator)
15943410 The sequential accumulation of mutations in adenomatous polyposis coli (APC)drives the transition from normal epithelium through increasing adenomatous dysplasia to colorectal cancer.
15929773 The I1307K mutation is associated with a moderate excess risk for CRC, but age of onset seems not to be earlier and this variant is not associated with a multiple colonic polyp phenotype.
15833136 analysis of rare mutations predisposing to familial adenomatous polyposis
15832580 The APC mutations associated wiht desmoid tumors and responsible for the behavior of the invasiveness of these neoplasms.
15824157 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15821699 This gene encodes a tumor suppressor protein that includes among its many intracellular functions one of nuclear export. Defects in this gene cause familial adenomatous polyposis (FAP).
15768050 results indicate that the APC may be a candidate gene conferring susceptibility to schizophrenia and also may be associated with reduced vulnerability to cancer in schizophrenia.
15761860 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15755874 APC induces apoptosis and thus plays a role in tumor suppression.
15754020 contribution of down-regulated APC expression to the development of human oral squamous cell carcinoma was about 30%
15733272 Observational study of gene-disease association. (HuGE Navigator)
15689459 Large deletions in the APC gene are a common cause of typical familial adenomatous polyposis.
15640937 Feeding of Apc1638N transgenic mice with enriched diet with probiotic components during 8 months have shown a minor therapeutic effect.
15639864 Observational study of gene-disease association. (HuGE Navigator)
15591320 identify selective beta-catenin binding hot spots of Tcf4, E-cadherin, and APC
15561772 Truncating APC mutations have dominant effects on cell proliferation, spindle checkpoint control, survival and chromosome stability.
15548520 identified a sequence in APC that binds POLB and blocks POLB-mediated strand-displacement synthesis in long patch BER without affecting short patch BER; APC gene expression is required for DNA methylation-induced sensitivity of colon cancer cells
15542524 Observational study of gene-disease association. (HuGE Navigator)
15540296 Observational study of gene-disease association. (HuGE Navigator)
15523694 Observational study of gene-disease association. (HuGE Navigator)
15520370 Observational study of gene-disease association. (HuGE Navigator)
15507235 Observational study of genotype prevalence. (HuGE Navigator)
15459959 first systematic evaluation of different single-base substitutions in APC at or close to splice sites at the transcript level, found in familial adenomatous polyposis patients
15446460 Observational study of gene-disease association. (HuGE Navigator)
15375803 Review of APC mutation that leads to genetic unstability in carcinogenesis of colon cancer
15355978 APC is down-regulated by the ubiquitin-proteasome pathway in a process facilitated by Axin
15331612 APC forms complex with AP-2alpha and beta-catenin and sequesters beta-catenin away from TCF/LEF transcription factors.
15327769 Results describe the crystal structure of beta-catenin in complex with a phosphorylated adenomatous polyposis coli (APC) fragment containing two 20-amino-acid repeats, whose phosphorylation could be a critical switch for APC function.
15326380 APC promoter hypermethylation contributes to the loss of APC expression in colorectal cancers with allelic loss on 5q
15273719 All three APC isoforms showing a different effect on tumorigenesis may be nontranscriptional in origin.
15266213 Observational study of genotype prevalence. (HuGE Navigator)
15257316 Results conclude about important role of APC alterations for melanoma progression.
15251938 The tumor suppressor gene, APC, is an independent prognostic parameter with poor outcome in breast cancer patients.
15190067 APC and CDX2 have roles in controlling retinoic acid biosynthesis and in promoting a retinoid-induced program of colonocyte differentiation
15133491 Genetic and epigenetic alterations of the APC gene were studied in malignant melanoma.
15122587 Observational study of gene-disease association. (HuGE Navigator)
15108288 Observational study of gene-disease association. (HuGE Navigator)
15040027 Mutations of APC gene were detected in more than half of hereditary non-polyposis colorectal cancers (HNPCC). Mutation was common molecular event and might play important role in tumorigenesis of HNPCC
15020226 Mucin 1 and adenomatous polyposis coli co-immunoprecipitate in breast cancer cells.
14991743 APC/GSK-3beta, through beta-catenin, may crossregulate NF-kappaB signaling pathway
14961559 This study enlarges the spectrum of APC gene mutations and sheds light on the correlation between the site of APC germline mutations and clinical manifestations of familial adenomatous polyposis.
14871261 APC protein was expressed in the cytoplasm of a very small number of prospermatogonia and interstitial (Leydig) cells in testis fetal development
14729851 Novel germline mutations in APC exons 5 and 11 affected age of onset in Polish Adenomatous Polyposis Coli patients Complicated with brain cancer.
14691304 Familial adenomatous polyposis/attenuated adenomatous polyposis coli can result from APC constitutive haploinsufficiency, with gene deletion being a possible cause of reduced gene expression.
14679305 a role in cell adhesion in addition to its known role in beta-catenin transcriptional signalling
14672538 REVIEW: Role of APC and DNA mismatch repair genes in the development of colorectal cancers.
14662741 Data suggest that adenomatous polyposis coli modulates microtubule plus-end attachments during mitosis, and its mutation predisposes cells to increased mitotic abnormalities, which may contribute to tumor progression.
14624392 Observational study of gene-disease association. (HuGE Navigator)
14579148 Observational study of gene-disease association. (HuGE Navigator)
14578138 Observational study of gene-disease association. (HuGE Navigator)
14578136 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
14574158 Mutations in apc gene is associated with both familial adenomatous polyposis and thyroid carcinoma
14573780 Observational study of genetic testing. (HuGE Navigator)
14520463 Decreased expression of adenomatosis polyposis coli protein is associated with ovarian epithelial cell transformation and in tumour progression
14514668 neither APC nor p150glued binding domain is necessary for EB1 or EBF3 to induce microtubule bundling
12955080 nuclear targeting of APC is driven by cell cycle entry rather than altered cell-cell contact. The ability of truncated APC to accumulate in the nucleus suggests that nuclear import signals other than NLS1(APC) and NLS2(APC) are functionally important.
12907646 APC mutation is associated with gain of 7p in colorectal adenocarcinoma.
12901799 Arg283Ter mutation in the APC gene is causative of the adenomatous polyposis coli phenotype in a Chinese family.
12856637 Observational study of gene-disease association. (HuGE Navigator)
12800196 APC inactivation due to mutations, LOH and methylation is associated with invasive and in situ lobular breast cancer.
12800081 Beta-catenin can increase sensitivity of the androgen receptor, it may be assumed that the increased beta-catenin-expression in angiofibromas is involved in the typical growth stimulus of this tumor in adolescent males.
12737446 APC mutations were found in 37/56 adenomas. The lack of the proliferative stimulus resulting from a K-ras mutation may contribute to the process of adenoma regression.
12655564 The APC I1307K mutation may contribute to colorectal cancers (CRC) in Israeli Arabs; inactivating mutations of MSH2 and MLH1 may not be a major cause for early onset CRC.
12647217 study verified reduced expressions of adenomatous polyposis coli and E-cadherin proteins in colorectal cancer cells and suggests that normal protein expressions in benign epithelium are progressively and independently lost in sporadic colorectal cancers
12606575 Data indicate that the rate of nuclear export of adenomatous polyposis coli protein (APC), rather than its nuclear import or steady-state levels, determines the transcriptional activity of beta-catenin.
12584179 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12581900 Novel mutations of the APC gene in familial adenomatous polyposis in Greek patients.
12575848 In human pilomatricoma,loss of heterozygosity was observed in the APC gene, but no mutations in the mutation cluster region were found in seven tumours without beta-catenin mutations.
12538344 Human DNA methyltransferase gene DNMT1 is regulated by the APC pathway
12537656 Observational study of gene-disease association. (HuGE Navigator)
12508668 Observational study of genetic testing. (HuGE Navigator)
12504226 Partial loss of function of APC protein by truncation of its carboxy(C)-terminus is an early factor in the development of many colorectal neoplasms.
12485844 structure of the amino-terminal nuclear export domain
12439748 implication of activation of the APC/beta-catenin signalling pathway due to beta-catenin mutations in the development of a subset of endometrial carcinomas
12387883 role in mediating growth-suppressive effect of gut-enriched Kruppel-like factor
12378616 APC mutation is involved in carcinogenesis of intestinal type of gastric cancer and is independent of MSI phenotype but related to the LOH pathway in gastric cancer.
12374230 Alternations in the APC gene mutations are involved in tumor growth and in tumor progression.
12173321 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
12173026 Pathogenic mutations and rare variants of the gene identified in 75 Belgian patients with familial adenomatous polyposis by fluorescent enzymatic mutation detection
12163385 somatic mutation of the APC gene plays an important role in the pathogenesis of gastric adenoma and dysplasia
12136240 Different familial adenomatous polyposis phenotypes resulting from deletions of the entire APC exon 15
12124804 Molecular genetic analysis of malignant melanomas for aberrations of the WNT signaling pathway genes CTNNB1, APC, ICAT and BTRC.
12093899 Mutations in APC, Kirsten-ras, and p53--alternative genetic pathways to colorectal cancer. The most common combination of mutations was p53 and APC (27.1%), whereas mutations in both p53 and K-ras were extremely rare.
12070164 demonstration of the direct interaction of APC-(129-250) fragment with the nuclear export factor chromosome maintenance region 1 (Crm-1)
12057910 Observational study of gene-disease association. (HuGE Navigator)
12045208 results indicate selection for APC genotypes that are likely to retain some activity in downregulating beta-catenin signaling
12034871 alleles produce functional protein from internal translation initiation
11972058 Association and regulation of casein kinase 2 activity by adenomatous polyposis coli protein
11956815 Dysfunction of APC may be a major cause of changes in beta-catenin function in colorectal tumors.
11933206 APC germline mutations identified in Czech patients with familial adenomatous polyposis: includes 11 which were not previously reported
11921277 Three APC mutations have been identified in 22 tested samples, all of them in xenografts developed from metastatic prostate tumors.
11920497 mutations rare in ulcerative colitis-related colorectal carcinomas; significant difference in frequency of APC mutations seen between right- and left-sided sporadic tumors suggests different molecular pathways
11912492 APC interacts with the kinesin superfamily
11891193 Molecular alterations in the APC/beta-catenin pathway were detected in 23.5% (4 of 17) of the pancreatic acinar cell carcinomas
11868006 Observational study of gene-disease association. (HuGE Navigator)
11868006 Older age and APC mutation in the central part of the gene are risk factors for the development of severe duodenojejunal polyposis. Location of the mutation affects severity of familial adenomatous polyposis.
11856748 androgen receptor does not interact with adenomatous polyposis coli or glycogen synthase kinase-3beta and, therefore, conclude that androgen-mediated transport of beta-catenin occurs through a distinct pathway.
11809682 Quantitative adenomatous polyposis coli promoter methylation analysis in tumor tissue, serum, and plasma DNA of patients with lung cancer.
11809680 Different combinations of biallelic APC mutation confer different growth advantages in colorectal tumours.
11768390 silent mutation in exon 14 of the APC gene is associated with exon skipping in a FAP family
11768389 novel 3' mutation in the APC gene in a family presenting with a desmoid tumour and minimal colonic phenotype
11754114 Maternal mosaicism for a second mutational event-a novel deletion-in a familial adenomatous polyposis family harboring a new germ-line mutation in the alternatively spliced-exon 9 region of APC.
11751382 APC regulates survivin expression: a possible mechanism contributing to the stem cell origin of colon cancer.
11748858 Nine mutations were novel and eight families were shown to harbor two recurrent mutations.
11741105 Mutations in APC coding region are not the sole cause of FAP or CHRP
11720476 Observational study of gene-disease association. (HuGE Navigator)
11696170 Results suggest that mutations of the beta-catenin and APC genes are rare and that activation of the Wnt signaling pathway may not contribute to pathogenesis in human papillary and follicular thyroid carcinomas.
11668620 Mutation analysis in northwest Spanish patients with familial adenomatous polyposis (FAP) and sporadic colorectal cancer
11606402 Observational study of genetic testing. (HuGE Navigator)
11584047 Asp1822Val variant is a common polymorphism without clinical implications
11535846 Observational study of gene-environment interaction. (HuGE Navigator)
11487538 Meta-analysis of gene-disease association. (HuGE Navigator)
11483640 Observational study of genetic testing. (HuGE Navigator)
11466700 Observational study of genotype prevalence. (HuGE Navigator)
11354631 Observational study of gene-disease association. (HuGE Navigator)
11241320 Observational study of gene-disease association. (HuGE Navigator)
11221825 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11159880 Observational study of genetic testing. (HuGE Navigator)

AA Sequence

MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAMASSGQIDLLE      1 - 70
RLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPRRGFVNGSRESTGYLEELEKE     71 - 140
RSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSLQTDMTRRQLEYEARQIRVAMEEQLGTCQDM    141 - 210
EKRAQRRIARIQQIEKDILRIRQLLQSQATEAERSSQNKHETGSHDAERQNEGQGVGEINMATSGNGQGS    211 - 280
TTRMDHETASVLSSSSTHSAPRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQS    281 - 350
GCLPLLIQLLHGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC    351 - 420
WEWQEAHEPGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGGLQAIAELLQVDCEMYGLTN    421 - 490
DHYSITLRRYAGMALTNLTFGDVANKATLCSMKGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSK    491 - 560
KTLREVGSVKALMECALEVKKESTLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLA    561 - 630
IIESGGGILRNVSSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWD    631 - 700
MGAVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEAELDAQHLS    701 - 770
ETFDNIDNLSPKASHRSKQRHKQSLYGDYVFDTNRHDDNRSDNFNTGNMTVLSPYLNTTVLPSSSSSRGS    771 - 840
LDSSRSEKDRSLERERGIGLGNYHPATENPGTSSKRGLQISTTAAQIAKVMEEVSAIHTSQEDRSSGSTT    841 - 910
ELHCVTDERNALRRSSAAHTHSNTYNFTKSENSNRTCSMPYAKLEYKRSSNDSLNSVSSSDGYGKRGQMK    911 - 980
PSIESYSEDDESKFCSYGQYPADLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWA    981 - 1050
RPKHIIEDEIKQSEQRQSRNQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGANGSETNRVGSNHG   1051 - 1120
INQNVSQSLCQEDDYEDDKPTNYSERYSEEEQHEEEERPTNYSIKYNEEKRHVDQPIDYSLKYATDIPSS   1121 - 1190
QKQSFSFSKSSSGQSSKTEHMSSSSENTSTPSSNAKRQNQLHPSSAQSRSGQPQKAATCKVSSINQETIQ   1191 - 1260
TYCVEDTPICFSRCSSLSSLSSAEDEIGCNQTTQEADSANTLQIAEIKEKIGTRSAEDPVSEVPAVSQHP   1261 - 1330
RTKSSRLQGSSLSSESARHKAVEFSSGAKSPSKSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSFESRS   1331 - 1400
IASSVQSEPCSGMVSGIISPSDLPDSPGQTMPPSRSKTPPPPPQTAQTKREVPKNKAPTAEKRESGPKQA   1401 - 1470
AVNAAVQRVQVLPDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESE   1471 - 1540
QPKESNENQEKEAEKTIDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTASKLPPPVARKPS   1541 - 1610
QLPVYKLLPSQNRLQPQKHVSFTPGDDMPRVYCVEGTPINFSTATSLSDLTIESPPNELAAGEGVRGGAQ   1611 - 1680
SGEFEKRDTIPTEGRSTDEAQGGKTSSVTIPELDDNKAEEGDILAECINSAMPKGKSHKPFRVKKIMDQV   1681 - 1750
QQASASSSAPNKNQLDGKKKKPTSPVKPIPQNTEYRTRVRKNADSKNNLNAERVFSDNKDSKKQNLKNNS   1751 - 1820
KVFNDKLPNNEDRVRGSFAFDSPHHYTPIEGTPYCFSRNDSLSSLDFDDDDVDLSREKAELRKAKENKES   1821 - 1890
EAKVTSHTELTSNQQSANKTQAIAKQPINRGQPKPILQKQSTFPQSSKDIPDRGAATDEKLQNFAIENTP   1891 - 1960
VCFSHNSSLSSLSDIDQENNNKENEPIKETEPPDSQGEPSKPQASGYAPKSFHVEDTPVCFSRNSSLSSL   1961 - 2030
SIDSEDDLLQECISSAMPKKKKPSRLKGDNEKHSPRNMGGILGEDLTLDLKDIQRPDSEHGLSPDSENFD   2031 - 2100
WKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSGISLGSPFHLTPDQEEKPFTSNKGPRILKP   2101 - 2170
GEKSTLETKKIESESKGIKGGKKVYKSLITGKVRSNSEISGQMKQPLQANMPSISRGRTMIHIPGVRNSS   2171 - 2240
SSTSPVSKKGPPLKTPASKSPSEGQTATTSPRGAKPSVKSELSPVARQTSQIGGSSKAPSRSGSRDSTPS   2241 - 2310
RPAQQPLSRPIQSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLTK   2311 - 2380
QTGLSKNASSIPRSESASKGLNQMNNGNGANKKVELSRMSSTKSSGSESDRSERPVLVRQSTFIKEAPSP   2381 - 2450
TLRRKLEESASFESLSPSSRPASPTRSQAQTPVLSPSLPDMSLSTHSSVQAGGWRKLPPNLSPTIEYNDG   2451 - 2520
RPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRVSTWRRTGSSSSILSASSESSEKAKSEDEK   2521 - 2590
HVNSISGTKQSKENQVSAKGTWRKIKENEFSPTNSTSQTVSSGATNGAESKTLIYQMAPAVSKTEDVWVR   2591 - 2660
IEDCPINNPRSGRSPTGNTPPVIDSVSEKANPNIKDSKDNQAKQNVGNGSVPMRTVGLENRLNSFIQVDA   2661 - 2730
PDQKGTEIKPGQNNPVPVSETNESSIVERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADSTSA   2731 - 2800
RPSQIPTPVNNNTKKRDSKTDSTESSGTQSPKRHSGSYLVTSV                              2801 - 2843
//

Text Mined References (671)

PMID Year Title
26884349 2016 Promoter methylation of ITF2, but not APC, is associated with microsatellite instability in two populations of colorectal cancer patients.
26681652 2016 Promoter methylation of APC and RAR-? genes as prognostic markers in non-small cell lung cancer (NSCLC).
26658612 2016 APC binds the Miro/Milton motor complex to stimulate transport of mitochondria to the plasma membrane.
26650777 2016 Genetic heterogeneity in synchronous colorectal cancers impacts genotyping approaches and therapeutic strategies.
26625971 2016 Novel and reported APC germline mutations in Chinese patients with familial adenomatous polyposis.
26613750 2016 Low-level APC mutational mosaicism is the underlying cause in a substantial fraction of unexplained colorectal adenomatous polyposis cases.
26556314 2016 APC functions at the centrosome to stimulate microtubule growth.
26511139 2015 Correlation between mutations and mRNA expression of APC and MUTYH genes: new insight into hereditary colorectal polyposis predisposition.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26447891 2016 High-resolution Melting Analysis for Gene Scanning of Adenomatous Polyposis Coli (APC) Gene With Oral Squamous Cell Carcinoma Samples.
26446593 2016 Contribution of APC and MUTYH mutations to familial adenomatous polyposis susceptibility in Hungary.
26436499 2015 Male-specific association of the APC rs383830 T allele with the risk of coronary heart disease.
26421687 2016 The APC I1307K allele conveys a significant increased risk for cancer.
26393419 2015 A novel GSK3-regulated APC:Axin interaction regulates Wnt signaling by driving a catalytic cycle of efficient ?catenin destruction.
26320184 2015 Adenomatous polyposis coli mutants dominantly activate Hsf1-dependent cell stress pathways through inhibition of microtubule dynamics.
26314409 2016 Association of APC I1307K and E1317Q polymorphisms with colorectal cancer among Egyptian subjects.
26311738 2015 A novel pathogenic germline mutation in the adenomatous polyposis coli gene in a Chinese family with familial adenomatous coli.
26309368 2015 Presence of c.3956delC mutation in familial adenomatous polyposis patients from Brazil.
26252100 2015 [Analysis of C.3925_3929 deletional mutations of APC gene in pedigrees with familial adenomatous polyposis].
26246425 2015 Black raspberries suppress colonic adenoma development in ApcMin/+ mice: relation to metabolite profiles.
26179480 2015 Desmoid tumors complicating Familial Adenomatous Polyposis: a meta-analysis mutation spectrum of affected individuals.
26073472 2015 Prognostic role of APC and RASSF1A promoter methylation status in cell free circulating DNA of operable gastric cancer patients.
26049416 2015 APC selectively mediates response to chemotherapeutic agents in breast cancer.
25908636 2015 Expression and promoter methylation status of hMLH1, MGMT, APC, and CDH1 genes in patients with colon adenocarcinoma.
25853848 2015 Association of APC, GSTP1 and SOCS1 promoter methylation with the risk of hepatocellular carcinoma: a meta-analysis.
25751801 2015 Desmoids and genotype in familial adenomatous polyposis.
25738352 2015 Correlation between the expression of DNMT1, and GSTP1 and APC, and the methylation status of GSTP1 and APC in association with their clinical significance in prostate cancer.
25684670 2015 Aberrant methylation of APC and RAR?2 genes in breast cancer patients.
25676610 2015 A novel APC mutation defines a second locus for Cenani-Lenz syndrome.
25604157 2015 High-resolution melting (HRM) re-analysis of a polyposis patients cohort reveals previously undetected heterozygous and mosaic APC gene mutations.
25578398 2015 The APC tumor suppressor is required for epithelial cell polarization and three-dimensional morphogenesis.
25514805 2015 Genome-wide hypomethylation and specific tumor-related gene hypermethylation are associated with esophageal squamous cell carcinoma outcome.
25449083 2014 [Analysis of APC gene mutation in a familial adenomatous polyposis pedigree].
25417611 2014 Promoter hypermethylation of p16 and APC in gastrointestinal cancer patients.
25250560 2015 Identification of novel mutations by exome sequencing in African American colorectal cancer patients.
25243319 2015 APC promoter 1B deletion in seven American families with familial adenomatous polyposis.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25210923 2014 The association between DNA copy number aberrations at chromosome 5q22 and gastric cancer.
25183641 2014 Molecular analysis of the APC gene in Sicilian patients with familial adenomatous polyposis (F.A.P.).
25150829 2014 N-terminal truncation mutations of adenomatous polyposis coli are associated with primary cilia defects.
25107489 2014 Promoter methylation analysis of WNT/?-catenin pathway regulators and its association with expression of DNMT1 enzyme in colorectal cancer.
25025473 2014 Mutations of C-reactive protein (CRP) -286 SNP, APC and p53 in colorectal cancer: implication for a CRP-Wnt crosstalk.
24946964 2014 Promoter-specific alterations of APC are a rare cause for mutation-negative familial adenomatous polyposis.
24861525 Genetic analysis in APC, KRAS, and TP53 in patients with stomach and colon cancer.
24747657 2014 Clinical validation of an epigenetic assay to predict negative histopathological results in repeat prostate biopsies.
24735542 2014 A de novo germline mutation of APC for inheritable colon cancer in a Chinese family using multigene next generation sequencing.
24722208 2014 different Roles for the axin interactions with the SAMP versus the second twenty amino acid repeat of adenomatous polyposis coli.
24715170 2014 Peptidyl-prolyl isomerase Pin1-mediated abrogation of APC-?-catenin interaction in squamous cell carcinoma of cervix.
24667635 2014 RIP140 increases APC expression and controls intestinal homeostasis and tumorigenesis.
24664543 2014 Fibro-osseous lesions of the craniofacial bones: ?-catenin immunohistochemical analysis and CTNNB1 and APC mutation analysis.
24664542 2014 Two Chinese pedigrees for adenomatous polyposis coli: new mutations at codon 1309 and predisposition to phenotypic variations.
24599579 2014 The UMD-APC database, a model of nation-wide knowledge base: update with data from 3,581 variations.
24590585 2014 APC alterations are frequently involved in the pathogenesis of acinar cell carcinoma of the pancreas, mainly through gene loss and promoter hypermethylation.
24549056 2014 Attenuated familial adenomatous polyposis manifests as autosomal dominant late-onset colorectal cancer.
24496450 2014 Regulation of the phosphorylation and nuclear import and export of ?-catenin by APC and its cancer-related truncated form.
24444033 2015 Musashi1 regulates survival of hepatoma cell lines by activation of Wnt signalling pathway.
24416237 2014 Colorectal tumors from APC*I1307K carriers principally harbor somatic APC mutations outside the A8 tract.
24390805 2014 Effects of genistein and daidzein on cell proliferation kinetics in HT29 colon cancer cells: the expression of CTNNBIP1 (?-catenin), APC (adenomatous polyposis coli) and BIRC5 (survivin).
24320611 2014 Physiological expression of the PI3K-activating mutation Pik3ca(H1047R) combines with Apc loss to promote development of invasive intestinal adenocarcinomas in mice.
24309598 2014 A novel APC gene mutation associated with a severe phenotype in a patient with Turcot syndrome.
24296361 2014 Gene expression profile in fibroblasts of Huntington's disease patients and controls.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24251807 2014 Adenomatous polyposis coli (APC) membrane recruitment 3, a member of the APC membrane recruitment family of APC-binding proteins, is a positive regulator of Wnt-?-catenin signalling.
24197976 2014 Expression of APC, ?-catenin and E-cadherin in Tunisian patients with gastric adenocarcinoma: clinical significance.
24139208 2013 Adenomatous polyposis coli gene involvement in ileal enterochromaffin cell neuroendocrine neoplasms.
24130866 2013 Large extent of disorder in Adenomatous Polyposis Coli offers a strategy to guard Wnt signalling against point mutations.
24115276 2014 The regulation and deregulation of Wnt signaling by PARK genes in health and disease.
24078348 2014 An analysis of polymorphisms within the Wnt signaling pathway in relation to ovarian cancer risk in a Polish population.
24005794 2013 Ultrasensitive detection of unknown colon cancer-initiating mutations using the example of the Adenomatous polyposis coli gene.
23983135 2013 Dietary heme iron and the risk of colorectal cancer with specific mutations in KRAS and APC.
23970361 2013 APC germline mutations in families with familial adenomatous polyposis.
23896379 2013 The APC p.I1307K polymorphism is a significant risk factor for CRC in average risk Ashkenazi Jews.
23874531 2013 Methylation of APC and GSTP1 in non-neoplastic tissue adjacent to prostate tumour and mortality from prostate cancer.
23873622 2013 A new germline stop codon mutation in exon 15 of the APC gene predisposing to familial adenomatous polyposis.
23871111 2013 A relay mechanism between EB1 and APC facilitate STIM1 puncta assembly at endoplasmic reticulum-plasma membrane junctions.
23846443 2013 Detailed molecular genetics of the APC*E1317Q mutation in tumor tissue suggest it may not be pathologically significant.
23840886 2013 Functional comparison of human adenomatous polyposis coli (APC) and APC-like in targeting beta-catenin for degradation.
23796566 2013 Upregulated miR-155 in papillary thyroid carcinoma promotes tumor growth by targeting APC and activating Wnt/?-catenin signaling.
23773491 2013 The prognostic significance of APC gene mutation and miR-21 expression in advanced-stage colorectal cancer.
23725351 2014 APC promoter 1B deletion in familial polyposis--implications for mutation-negative families.
23646120 2013 Tissue-dependent consequences of Apc inactivation on proliferation and differentiation of ciliated cell progenitors via Wnt and notch signaling.
23561487 2013 Mutational spectrum of the APC and MUTYH genes and genotype-phenotype correlations in Brazilian FAP, AFAP, and MAP patients.
23555190 2013 Adenomatous polyposis coli-mediated accumulation of abasic DNA lesions lead to cigarette smoke condensate-induced neoplastic transformation of normal breast epithelial cells.
23525311 2013 CTNNB1, AXIN1 and APC expression analysis of different medulloblastoma variants.
23504555 2013 Analysis of the methylation patterns of the p16 INK4A, p15 INK4B, and APC genes in gastric adenocarcinoma patients from a Brazilian population.
23469016 2013 Gas2l3, a novel constriction site-associated protein whose regulation is mediated by the APC/C Cdh1 complex.
23405266 2013 Common genetic variants in Wnt signaling pathway genes as potential prognostic biomarkers for colorectal cancer.
23393221 2013 Regulation of APC and AXIN2 expression by intestinal tumor suppressor CDX2 in colon cancer cells.
23382461 2013 APC binds intermediate filaments and is required for their reorganization during cell migration.
23334997 2013 Desmoid tumour biology in patients with familial adenomatous polyposis coli.
23326336 2013 Comparison study of MS-HRM and pyrosequencing techniques for quantification of APC and CDKN2A gene methylation.
23302090 2013 APC/?-catenin-rich complexes at membrane protrusions regulate mammary tumor cell migration and mesenchymal morphology.
23299921 2013 APC gene hypermethylation and prostate cancer: a systematic review and meta-analysis.
23291410 2013 Novel insertion mutation p.Asp610GlyfsX23 in APC gene causes familial adenomatous polyposis in Chinese families.
23277359 2013 HectD1 E3 ligase modifies adenomatous polyposis coli (APC) with polyubiquitin to promote the APC-axin interaction.
23244118 2012 Colon cancer prevention by detection of APC gene mutation in a family with attenuated familial adenomatous polyposis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23159591 2013 APC germline mutations in individuals being evaluated for familial adenomatous polyposis: a review of the Mayo Clinic experience with 1591 consecutive tests.
23159080 2012 [Expression of Wnt5a, APC, ?-catenin and their clinical significance in human colorectal adenocarcinoma].
23131390 2013 A clinical-biological risk stratification model for resected gastric cancer: prognostic impact of Her2, Fhit, and APC expression status.
23087084 2013 miR-106b downregulates adenomatous polyposis coli and promotes cell proliferation in human hepatocellular carcinoma.
23085758 2013 Different APC genotypes in proximal and distal sporadic colorectal cancers suggest distinct WNT/?-catenin signalling thresholds for tumourigenesis.
23055343 2012 Aberrant promoter methylation of the RASSF1A and APC genes in epithelial ovarian carcinoma development.
23011394 2012 Loss of adenomatous poliposis coli-?3 integrin interaction promotes endothelial apoptosis in mice and humans.
22987206 2013 Novel mutations of the APC gene and genetic consequences of splicing mutations in the Czech FAP families.
22976915 2013 Clinical and molecular features of attenuated adenomatous polyposis in northern Italy.
22907428 2013 A novel miR-193a-5p-YY1-APC regulatory axis in human endometrioid endometrial adenocarcinoma.
22898821 2012 Amer2 protein interacts with EB1 protein and adenomatous polyposis coli (APC) and controls microtubule stability and cell migration.
22893084 2012 Epiretinal membrane and retinal pigment epithelial lesions in a young child and detection of de novo APC mutation.
22886683 2012 Multiple jejunal cancers resulting from combination of germline APC and MLH1 mutations.
22884971 2012 Copy number variation of the APC gene is associated with regulation of bone mineral density.
22864938 2012 Dietary, lifestyle and clinicopathological factors associated with APC mutations and promoter methylation in colorectal cancers from the EPIC-Norfolk study.
22851115 2012 Prevalence and phenotypes of APC and MUTYH mutations in patients with multiple colorectal adenomas.
22825279 2012 Perinatal detection of familial adenomatous polyposis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22796397 2012 Association study of APC polymorphisms with colorectal cancer in Han Chinese.
22795047 Association of APC and REEP5 gene polymorphisms with major depression disorder and treatment response to antidepressants in a Han Chinese population.
22787431 2012 Adenomatous polyposis coli interacts with flap endonuclease 1 to block its nuclear entry and function.
22761442 2012 Reversible modification of adenomatous polyposis coli (APC) with K63-linked polyubiquitin regulates the assembly and activity of the ?-catenin destruction complex.
22741528 2012 Hypermethylation of adenomatous polyposis coli gene promoter is associated with novel Wnt signaling pathway in gastric adenomas.
22740476 2012 Restoration of full-length APC protein in SW480 colon cancer cells induces exosome-mediated secretion of DKK-4.
22719865 2012 The adenomatous polyposis coli protein contributes to normal compaction of mitotic chromatin.
22704062 2012 Epithelial to mesenchymal transition (EMT) biomarkers--E-cadherin, beta-catenin, APC and Vimentin--in oral squamous cell carcinogenesis and transformation.
22682247 2012 Wnt signaling through inhibition of ?-catenin degradation in an intact Axin1 complex.
22669205 2012 Missense mutations in MLH1, MSH2, KRAS, and APC genes in colorectal cancer patients in Malaysia.
22528324 2012 Genetic variations in stem cell-related genes and colorectal cancer prognosis.
22509309 2012 A common role for various human truncated adenomatous polyposis coli isoforms in the control of beta-catenin activity and cell proliferation.
22496417 2012 APC and Smad7 link TGF? type I receptors to the microtubule system to promote cell migration.
22469663 2012 Identification of a Wnt-induced protein complex by affinity proteomics using an antibody that recognizes a sub-population of ?-catenin.
22434720 2012 A functional network of the tumor suppressors APC, hDlg, and PTEN, that relies on recognition of specific PDZ-domains.
22431159 2012 Deep intronic APC mutations explain a substantial proportion of patients with familial or early-onset adenomatous polyposis.
22380946 2012 Regulation of the metabolite profile by an APC gene mutation in colorectal cancer.
22372443 CTNNB1 genotyping and APC screening in pediatric desmoid tumors: a proposed algorithm.
22324744 2012 DNA alterations of microsatellite DNA, p53, APC and K-ras in Chinese colorectal cancer patients.
22294772 2012 In vitro stability of APC gene sequences and the influence of DNA repair status.
22277732 2012 Increased plasma levels of the APC-interacting protein MAPRE1, LRG1, and IGFBP2 preceding a diagnosis of colorectal cancer in women.
22262720 2012 APC gene deletions in gastric adenocarcinomas in a Chinese population: a correlation with tumour progression.
22184111 2012 Adenomatous polyposis coli (APC) regulates multiple signaling pathways by enhancing glycogen synthase kinase-3 (GSK-3) activity.
22128170 2012 Amer2 protein is a novel negative regulator of Wnt/?-catenin signaling involved in neuroectodermal patterning.
22103048 2011 The genetics of familial adenomatous polyposis (FAP) and MutYH-associated polyposis (MAP).
22081130 2011 Activation of beta-catenin is a late event in the pathogenesis of nephroblastomas and rarely correlated with genetic changes of the APC gene.
22077694 2012 Evaluation of GSTP1 and APC methylation as indicators for repeat biopsy in a high-risk cohort of men with negative initial prostate biopsies.
22073196 2011 Methylation of the CpG sites only on the sense strand of the APC gene is specific for hepatocellular carcinoma.
22012588 2012 Acute loss of DP1, but not DP2, induces p53 mRNA and augments p21Waf1/Cip1 and senescence.
22000517 2011 Crystal structures of the armadillo repeat domain of adenomatous polyposis coli and its complex with the tyrosine-rich domain of Sam68.
21995949 2012 Increased variance in germline allele-specific expression of APC associates with colorectal cancer.
21949247 2011 Maintenance of adenomatous polyposis coli (APC)-mutant colorectal cancer is dependent on Wnt/beta-catenin signaling.
21948542 2011 [Expression of DNA methylation of APC in peripheral blood and tumor tissue in patients with esophageal squamous cell carcinoma].
21915313 2011 Adenomatous polyposis coli regulates axon arborization and cytoskeleton organization via its N-terminus.
21909382 2011 Readthrough of premature termination codons in the adenomatous polyposis coli gene restores its biological activity in human cancer cells.
21904137 2011 Family history, surgery, and APC mutation are risk factors for desmoid tumors in familial adenomatous polyposis: an international cohort study.
21902576 2012 Genetic alterations in members of the Wnt pathway in acute leukemia.
21901162 2011 Molecular genetic analysis of 103 sporadic colorectal tumours in Czech patients.
21900494 2011 The tumor suppressor adenomatous polyposis coli controls the direction in which a cell extrudes from an epithelium.
21871439 2011 Crystal structure of the armadillo repeat domain of adenomatous polyposis coli which reveals its inherent flexibility.
21865138 2011 APC and KRAS mutations in distal colorectal polyps are related to smoking habits in men: results of a cross-sectional study.
21859464 2011 Messing up disorder: how do missense mutations in the tumor suppressor protein APC lead to cancer?
21858148 2011 Molecular basis for the recognition of adenomatous polyposis coli by the Discs Large 1 protein.
21857949 2011 Role of heterozygous APC mutation in niche succession and initiation of colorectal cancer--a computational study.
21807601 2011 Analysis of molecular aberrations of Wnt pathway gladiators in colorectal cancer in the Kashmiri population.
21788986 2012 Structural basis for the recognition of Asef by adenomatous polyposis coli.
21779980 2011 A survey of APC mutations in Quebec.
21737640 2011 Correlation between COX-2 and APC expression in left versus right-sided human colon cancer.
21680534 2011 Aberrant methylation of RARbeta2 and APC genes in voided urine as molecular markers for early detection of bilharzial and nonbilharzial bladder cancer.
21665989 2011 APC mutations in colorectal tumours from FAP patients are selected for CtBP-mediated oligomerization of truncated APC.
21664290 2011 Adenomatous polyposis coli protein regulates the cellular response to DNA replication stress.
21643010 2011 Inactivation of promoter 1B of APC causes partial gene silencing: evidence for a significant role of the promoter in regulation and causative of familial adenomatous polyposis.
21598003 2011 A novel pathogenic germline mutation in the adenomatous polyposis coli gene in a Tunisian family with FAP.
21573497 2011 Synergism between K-rasVal12 and mutant Apc accelerates murine large intestinal tumourigenesis.
21538028 2011 EBV-infection in cardiac and non-cardiac gastric adenocarcinomas is associated with promoter methylation of p16, p14 and APC, but not hMLH1.
21498506 2011 Structural and functional characterization of the Wnt inhibitor APC membrane recruitment 1 (Amer1).
21484796 2012 AP1B plays an important role in intestinal tumorigenesis with the truncating mutation of an APC gene.
21442240 2011 Brain metastases exhibit gross deletions of the APC gene.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21404461 2011 Proteomic identification of overexpressed adenomatous polyposis coli and cyclin B3 during endoderm differentiation from human embryonic stem cells.
21359685 2011 Detection of APC gene deletions in colorectal malignancies using quantitative PCR in a Chinese population.
21315632 2011 Germinoma presenting as a fourth cranial nerve palsy in a patient with adenomatous polyposis coli (APC) gene mutation.
21311754 2011 Rho GTPase Cdc42 is a direct interacting partner of Adenomatous Polyposis Coli protein and can alter its cellular localization.
21309064 2011 Molecular genetics of supernumerary tooth formation.
21302450 2010 [Expressions of APC and c-Myc and its implication on non-small cell lung cancer].
21279955 Association of APC and MCC polymorphisms with increased breast cancer risk in an Indian population.
21225915 2011 Analysis of the adenomatous polyposis coli (APC) gene in childhood and adolescent germ cell tumors.
21207416 2011 Association of tissue promoter methylation levels of APC, TGF?2, HOXD3 and RASSF1A with prostate cancer progression.
21199875 2011 Novel double-negative feedback loop between adenomatous polyposis coli and Musashi1 in colon epithelia.
21110124 2011 Mutation analysis of the APC gene in unrelated Korean patients with FAP: four novel mutations with unusual phenotype.
21078161 2010 Aberrant WNT/?-catenin signaling in parathyroid carcinoma.
21057000 2010 Survivin-induced Aurora-B kinase activation: A mechanism by which APC mutations contribute to increased mitoses during colon cancer development.
20978327 2010 EBV-infection in cardiac and non-cardiac gastric adenocarcinomas is associated with promoter methylation of p16, p14 and APC, but not hMLH1.
20978149 2010 Inactivation of the APC gene is constant in adrenocortical tumors from patients with familial adenomatous polyposis but not frequent in sporadic adrenocortical cancers.
20971552 2011 Hepatitis B viral X protein interacts with tumor suppressor adenomatous polyposis coli to activate Wnt/?-catenin signaling.
20937854 2010 ErbB2 receptor controls microtubule capture by recruiting ACF7 to the plasma membrane of migrating cells.
20936779 2010 A human MAP kinase interactome.
20935450 2010 Gene variants associated to malignant thyroid disease in familial adenomatous polyposis: a novel APC germline mutation.
20924072 2011 Clinical and genetic characterization of classical forms of familial adenomatous polyposis: a Spanish population study.
20887112 2010 Metachronous multifocal desmoid-type fibromatoses along the neuraxis with adenomatous polyposis syndrome.
20850014 2010 DNA demethylase activity maintains intestinal cells in an undifferentiated state following loss of APC.
20844743 2010 Single nucleotide polymorphisms in the Wnt and BMP pathways and colorectal cancer risk in a Spanish cohort.
20844082 2010 Adenomatous polyposis coli and hypoxia-inducible factor-1{alpha} have an antagonistic connection.
20840677 2010 Mutational analysis of E-cadherin, ?-catenin and APC genes in synovial sarcomas.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20723290 2010 [Effect of triptolide on reversing hypermethylation of apc gene in Jurkat cells and its possible mechanisms].
20696900 2010 PARK2 deletions occur frequently in sporadic colorectal cancer and accelerate adenoma development in Apc mutant mice.
20696710 2010 KIF17 stabilizes microtubules and contributes to epithelial morphogenesis by acting at MT plus ends with EB1 and APC.
20696638 2010 Methylated APC and GSTP1 genes in serum DNA correlate with the presence of circulating blood tumor cells and are associated with a more aggressive and advanced breast cancer disease.
20685668 2010 Germline APC mutation spectrum derived from 863 genomic variations identified through a 15-year medical genetics service to French patients with FAP.
20658693 2010 Cell type-specific expression of adenomatous polyposis coli in lung development, injury, and repair.
20649969 2010 Mutational spectrum of APC and genotype-phenotype correlations in Greek FAP patients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20613673 Association between polymorphisms in Wnt signaling pathway genes and bone mineral density in postmenopausal Korean women.
20570909 2010 Increased cancer predisposition in family members of colorectal cancer patients harboring the p.V600E BRAF mutation: a population-based study.
20564245 2010 APC mutations are associated with increased bone mineral density in patients with familial adenomatous polyposis.
20544848 2010 Colorectal cancers show distinct mutation spectra in members of the canonical WNT signaling pathway according to their anatomical location and type of genetic instability.
20519433 2010 Adenomatous polyposis coli regulates endothelial cell migration independent of roles in beta-catenin signaling and cell-cell adhesion.
20513532 2010 Three novel mutations of the APC gene in Korean patients with familial adenomatous polyposis.
20510605 2010 Polymorphisms in the adenomatous polyposis coli (APC) gene and advanced colorectal adenoma risk.
20509626 2010 Structural basis of the recognition of the SAMP motif of adenomatous polyposis coli by the Src-homology 3 domain.
20473645 2010 Parafibromin and APC as screening markers for malignant potential in atypical parathyroid adenomas.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20437058 2010 The utility and predictive value of combinations of low penetrance genes for screening and risk prediction of colorectal cancer.
20434453 2010 Allele-specific expression of APC in adenomatous polyposis families.
20371677 2010 Long interspersed nuclear element 1 hypomethylation is a marker of poor prognosis in stage IA non-small cell lung cancer.
20352275 2010 Risk factors predicting intra-abdominal desmoids in familial adenomatous polyposis: a single centre experience.
20333795 2010 APC gene mutations in Chinese familial adenomatous polyposis patients.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20229069 2010 Location in the large bowel influences the APC mutations observed in FAP adenomas.
20224554 2010 Binding of APC and dishevelled mediates Wnt5a-regulated focal adhesion dynamics in migrating cells.
20208994 2010 Frequent promoter hypermethylation of the APC and RASSF1A tumour suppressors in parathyroid tumours.
20149637 2010 Common variants in human CRC genes as low-risk alleles.
20092957 2010 Loss of heterozygosity of selected tumor suppressor genes in human testicular germ cell tumors.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20063100 2010 [Gardner fibroma: case report and discussion of a new soft tissue tumor entity].
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
20033212 2010 Large intron 14 rearrangement in APC results in splice defect and attenuated FAP.
20027139 2009 Polymorphisms in the adenomatous polyposis coli gene in Slovak families suspected of FAP.
20007843 2010 Combined iPLEX and TaqMan assays to screen for 45 common mutations in Lynch syndrome and FAP patients.
19966865 2010 Contribution of the 15 amino acid repeats of truncated APC to beta-catenin degradation and selection of APC mutations in colorectal tumours from FAP patients.
19945765 2010 DNA hypermethylation of tumors from non-small cell lung cancer (NSCLC) patients is associated with gender and histologic type.
19928354 2009 The adenomatous polyposis coli tumor suppressor and Wnt signaling in the regulation of apoptosis.
19928352 2009 The role of APC in mitosis and in chromosome instability.
19928349 2009 Nuclear APC.
19928347 2009 APC proteins. Preface.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19912361 2009 Hypermethylation of APC promoter 1A is associated with moderate activation of Wnt signalling pathway in a subset of colorectal serrated adenomas.
19900451 2010 The mitochondrial protein hTID-1 partners with the caspase-cleaved adenomatous polyposis cell tumor suppressor to facilitate apoptosis.
19900189 2010 APC promoter hypermethylation is an early event in endometrial tumorigenesis.
19893577 2009 The adenomatous polyposis coli-associated exchange factors Asef and Asef2 are required for adenoma formation in Apc(Min/+)mice.
19889076 2009 Host single nucleotide polymorphisms of MMP-9 -1562/TIMP-1 372 have gender differences in the risk of gastric intestinal metaplasia after Helicobacter pylori infection.
19888426 2009 Analysis of candidate genes in occurrence and growth of colorectal adenomas.
19845967 2009 Novel association of APC with intermediate filaments identified using a new versatile APC antibody.
19793053 2009 APC or MUTYH mutations account for the majority of clinically well-characterized families with FAP and AFAP phenotype and patients with more than 30 adenomas.
19777185 2010 Association analysis of Wnt pathway genes on prostate-specific antigen recurrence after radical prostatectomy.
19773381 2009 Aberrant methylation of APC, MGMT, RASSF2A, and Wif-1 genes in plasma as a biomarker for early detection of colorectal cancer.
19768578 2010 Mutation analysis of the APC gene in Taiwanese FAP families: low incidence of APC germline mutation in a distinct subgroup of FAP families.
19728755 2009 Different phenotype manifestation of familial adenomatous polyposis in families with APC mutation at codon 1309.
19703905 2009 Cyclin A/cdk2 regulates adenomatous polyposis coli-dependent mitotic spindle anchoring.
19701947 2009 The APC Variant p.Glu1317Gln predisposes to colorectal adenomas by a novel mechanism of relaxing the target for tumorigenic somatic APC mutations.
19694001 2009 Novel human pathological mutations. Gene symbol: APC. Disease: Adenomatous polyposis coli.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19679059 2009 A gene marker panel covering the Wnt and the Ras-Raf-MEK-MAPK signalling pathways allows to detect gene mutations in 80% of early (UICC I) colon cancer stages in humans.
19672874 2009 Integrative approach for prioritizing cancer genes in sporadic colon cancer.
19654215 2009 Nup358 interacts with APC and plays a role in cell polarization.
19632184 2009 An EB1-binding motif acts as a microtubule tip localization signal.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19617769 2009 APC somatic mosaicism in a patient with Gardner syndrome carrying the E1573X mutation: report of a case.
19615284 2009 [Correlation of BRCA1 and APC aberrant methylation with the response to anthracycline-based neoadjuvant chemotherapy in primary breast cancer].
19606680 2009 [Polymorphism/loss of heterozygosity of APC gene in GERD-Barrett's metaplasia-dysplasia-adenocarcinoma sequence].
19593690 2009 Relative role of APC and MUTYH mutations in the pathogenesis of familial adenomatous polyposis.
19584833 2009 DNA promoter hypermethylation of p16 and APC predicts neoplastic progression in Barrett's esophagus.
19576224 2009 The COP9 signalosome mediates beta-catenin degradation by deneddylation and blocks adenomatous polyposis coli destruction via USP15.
19571702 2009 Genotype predicting phenotype in familial adenomatous polyposis: a practical application to the choice of surgery.
19543899 2009 Analysis of mutations in TP53, APC, K-ras, and DCC genes in the non-dysplastic mucosa of patients with inflammatory bowel disease.
19531215 2009 Molecular analysis of the APC and MUTYH genes in Galician and Catalonian FAP families: a different spectrum of mutations?
19527921 2009 Adenomatous polyposis coli 1A is likely to be methylated as a passenger in human gastric carcinogenesis.
19527492 2009 Colorectal carcinomas in MUTYH-associated polyposis display histopathological similarities to microsatellite unstable carcinomas.
19525225 2009 Adenomatous polyposis coli and Asef function downstream of hepatocyte growth factor and phosphatidylinositol 3-kinase.
19515250 2009 A mitotic recombination map proximal to the APC locus on chromosome 5q and assessment of influences on colorectal cancer risk.
19506903 2009 RASSF1A, APC, ESR1, ABCB1 and HOXC9, but not p16INK4A, DAPK1, PTEN and MT1G genes were frequently methylated in the stage I non-small cell lung cancer in China.
19474113 2009 Risk of colorectal neoplasia associated with the adenomatous polyposis coli E1317Q variant.
19470943 2009 Promoter methylation in APC, RUNX3, and GSTP1 and mortality in prostate cancer patients.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19450512 2009 A two-step model for colon adenoma initiation and progression caused by APC loss.
19448414 2009 Expression and significance of adenomatous polyposis coli, beta-catenin, E-cadherin and cyclin D1 in esophageal squamous cell carcinoma assessed by tissue microarray.
19444466 2009 APC mutation spectrum of Norwegian familial adenomatous polyposis families: high ratio of novel mutations.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19378335 2009 Selective inhibition of proliferation in colorectal carcinoma cell lines expressing mutant APC or activated B-Raf.
19351817 2009 Genetic mutations associated with cigarette smoking in pancreatic cancer.
19337631 2009 Introduction of cytogenetic tests in colorectal cancer screening.
19309276 2009 The association of methylation in the promoter of APC and MGMT and the prognosis of Taiwanese CRC patients.
19307944 2009 Prognostic significance of interaction between somatic APC mutations and 5-fluorouracil adjuvant chemotherapy in Taiwanese colorectal cancer subjects.
19261806 2009 Oncogenic Adenomatous polyposis coli mutants impair the mitotic checkpoint through direct interaction with Mad2.
19196998 2009 Analysis of rare APC variants at the mRNA level: six pathogenic mutations and literature review.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19169759 2009 APC, MYH, and the correlation genotype-phenotype in colorectal polyposis.
19164452 2009 MGMT and MLH1 promoter methylation versus APC, KRAS and BRAF gene mutations in colorectal cancer: indications for distinct pathways and sequence of events.
19151759 2009 Asef2 and Neurabin2 cooperatively regulate actin cytoskeletal organization and are involved in HGF-induced cell migration.
19124205 2009 Analysis of APC, alpha-, beta-catenins, and N-cadherin protein expression in aggressive fibromatosis (desmoid tumor).
19111562 2009 A missense mutation in the APC tumor suppressor gene disrupts an ASF/SF2 splicing enhancer motif and causes pathogenic skipping of exon 14.
19110823 2008 Prognostic and therapeutic implications of Apc mutations in colorectal cancer.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19061640 2008 APC is essential for targeting phosphorylated beta-catenin to the SCFbeta-TrCP ubiquitin ligase.
19036155 2008 Broad phenotypic spectrum in familial adenomatous polyposis; from early onset and severe phenotypes to late onset of attenuated polyposis with the first manifestation at age 72.
19035518 2009 Association between adenomatosis polyposis coli functional status and microsomal prostaglandin E synthase-1 expression in colorectal cancer.
19029688 2008 APC gene mutations causing familial adenomatous polyposis in Polish patients.
19026650 2009 High detection rates of colorectal neoplasia by stool DNA testing with a novel digital melt curve assay.
19013464 2008 Hyperplastic polyps and sessile serrated adenomas as a phenotypic expression of MYH-associated polyposis.
18992635 2008 Prevalence of mutations in APC, CTNNB1, and BRAF in Tunisian patients with sporadic colorectal cancer.
18992263 2009 Colon tumor mutations and epigenetic changes associated with genetic polymorphism: insight into disease pathways.
18987576 2008 The spectrum of the APC pathogenic mutations in Slovak FAP patients.
18982352 2008 A large novel deletion in the APC promoter region causes gene silencing and leads to classical familial adenomatous polyposis in a Manitoba Mennonite kindred.
18977219 2008 Promoter hypermethylation leads to decreased APC mRNA expression in familial polyposis and sporadic colorectal tumours, but does not substitute for truncating mutations.
18955873 2008 Germline APC mutations are not commonly seen in children with sporadic hepatoblastoma.
18854359 2009 Beta-catenin degradation mediated by the CID domain of APC provides a model for the selection of APC mutations in colorectal, desmoid and duodenal tumours.
18847451 2009 Aberrant promoter CpG island hypermethylation of the adenomatosis polyposis coli gene can serve as a good prognostic factor by affecting lymph node metastasis in squamous cell carcinoma of the esophagus.
18844223 2009 Somatic mutations of adenomatous polyposis coli gene and nuclear b-catenin accumulation have prognostic significance in invasive urothelial carcinomas: evidence for Wnt pathway implication.
18841156 2008 Aberrant methylation of the Adenomatous Polyposis Coli (APC) gene promoter is associated with the inflammatory breast cancer phenotype.
18807072 2008 Exploration of the APC/beta-catenin (WNT) pathway and a histologic classification system for pulmonary artery intimal sarcoma. A study of 18 cases.
18774639 2008 Switch of transforming growth factor beta function from tumor suppression to stimulation in adenomatous polyposis coli (APC) knocked-down human colon carcinoma cells.
18770064 2008 Sporadic desmoid tumor in an Ashkenazi patient homozygous for the APC*I1307K gene mutation.
18708403 2008 Association of genetic variation in genes implicated in the beta-catenin destruction complex with risk of breast cancer.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18662849 2008 A novel function of adenomatous polyposis coli (APC) in regulating DNA repair.
18662704 2008 Epigenetic alterations of CDH1 and APC genes: relationship with activation of Wnt/beta-catenin pathway in invasive ductal carcinoma of breast.
18646694 2008 [Abnormalities of chromosome 8, APC and beta-catenin genes in aggressive fibromatosis].
18632987 2008 Interaction between tumor suppressor adenomatous polyposis coli and topoisomerase IIalpha: implication for the G2/M transition.
18632876 2008 Adenomatous polyposis coli alteration in digestive endocrine tumours: correlation with nuclear translocation of beta-catenin and chromosomal instability.
18632657 2008 Presence of a TA haplotype in the APC gene containing the common 1822 polymorphism and colorectal adenoma.
18632633 2008 Regulation of the adenomatous polyposis coli gene by the miR-135 family in colorectal cancer.
18630182 2008 [Single nucleotide c.645+32c>T substitution in the APC gene is a non-pathogenic polymorphism appearing in about 16% of the Czech population].
18629513 2008 Report of a family segregating mutations in both the APC and MSH2 genes: juvenile onset of colorectal cancer in a double heterozygote.
18617334 2008 Loss of heterozygosity of the APC gene in oral squamous cell carcinoma.
18612690 2008 Missense polymorphisms in the adenomatous polyposis coli gene and colorectal cancer risk.
18519734 2008 Original CIN: reviewing roles for APC in chromosome instability.
18502210 2008 The armadillo repeat domain of the APC tumor suppressor protein interacts with Striatin family members.
18498351 2008 Ligand-dependent interaction between estrogen receptor alpha and adenomatous polyposis coli.
18486530 2009 Aberrant beta-catenin expression and adenomatous polyposis coli gene mutation in ameloblastoma and odontogenic carcinoma.
18485586 2008 Methylation of the adenomatous polyposis coli (APC) gene in human placenta and hypermethylation in choriocarcinoma cells.
18483325 2008 DNA methylation in benign breast epithelium in relation to age and breast cancer risk.
18477604 2008 Novel self-association of the APC molecule affects APC clusters and cell migration.
18474248 2008 The APC tumor suppressor inhibits DNA replication by directly binding to DNA via its carboxyl terminus.
18454178 2008 Truncation mutations abolish chromatin-associated activities of adenomatous polyposis coli.
18451217 2008 Epigenetic-genetic interactions in the APC/WNT, RAS/RAF, and P53 pathways in colorectal carcinoma.
18433509 2008 Clinical characterization and the mutation spectrum in Swedish adenomatous polyposis families.
18418860 2008 APC mutation spectrum in ileoanal pouch polyps resembles that of colorectal polyps.
18406876 2008 Identification of a novel duplication in the APC gene using multiple ligation probe amplification in a patient with familial adenomatous polyposis.
18403596 2008 Cross-species comparison of human and mouse intestinal polyps reveals conserved mechanisms in adenomatous polyposis coli (APC)-driven tumorigenesis.
18393246 2008 [Germline mutation of adenomatous polyposis coli gene in Chinese patients with familial adenomatous polyposis].
18393237 2008 [Detection of adenomatous polyposis coli gene mutations in 31 familial adenomatous polyposis families by using denaturing high performance liquid chromatography].
18387968 2008 Functional definition of the mutation cluster region of adenomatous polyposis coli in colorectal tumours.
18384130 2008 Concomitant activation of Wnt pathway and loss of mismatch repair function in human melanoma.
18375958 2008 Modification of the associations between lifestyle, dietary factors and colorectal cancer risk by APC variants.
18369740 2008 Somatic APC inactivation mechanisms in sporadic colorectal cancer cases in Hungary.
18343606 2009 No evidence of the APC D1822V missense variant's pathogenicity in Tunisian patients with sporadic colorectal cancer.
18337602 2008 DNA methylation markers and early recurrence in stage I lung cancer.
18321998 2008 The in vivo rate of somatic adenomatous polyposis coli mutation.
18281465 2008 Trabid, a new positive regulator of Wnt-induced transcription with preference for binding and cleaving K63-linked ubiquitin chains.
18265644 2007 The differentially mutational spectra of the APC, K-ras, and p53 genes in sporadic colorectal cancers from Taiwanese patients.
18224684 2008 Difference in characteristics of APC mutations between colonic and extracolonic tumors of FAP patients: variations with phenotype.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18199528 2008 Multiple rare nonsynonymous variants in the adenomatous polyposis coli gene predispose to colorectal adenomas.
18166348 2008 Functional characterization of the novel APC N1026S variant associated with attenuated familial adenomatous polyposis.
18160396 2008 Mitochondrial targeting of adenomatous polyposis coli protein is stimulated by truncating cancer mutations: regulation of Bcl-2 and implications for cell survival.
18091433 2007 Heterogeneous molecular mechanisms underlie attenuated familial adenomatous polyposis.
18076571 2007 Putative tumor suppressor EDD interacts with and up-regulates APC.
18070451 2007 [Effect of Hydralazine on demethylation status and expression of APC gene, proliferation and apoptosis of human cervical cancer cell lines].
18066497 2008 Meningiomas exhibit loss of heterozygosity of the APC gene.
18063416 2008 American founder mutation for attenuated familial adenomatous polyposis.
18058812 2008 Quantitative, spatial resolution of the epigenetic field effect in prostate cancer.
18027849 2008 Germline hypermethylation of the APC promoter is not a frequent cause of familial adenomatous polyposis in APC/MUTYH mutation negative families.
18026870 2008 Gonadal mosaicism and familial adenomatous polyposis.
17973119 2008 APC promoter methylation and protein expression in hepatocellular carcinoma.
17968317 2008 Human APC sequesters beta-catenin even in the absence of GSK-3beta in a Drosophila model.
17964080 2008 Low-grade gastric adenomas/dysplasias: phenotypic expression, DNA ploidy pattern, and LOH at microsatellites linked to the APC gene.
17963004 2007 Mutational screening of the APC gene in Chilean families with familial adenomatous polyposis: nine novel truncating mutations.
17960617 2008 Promoter hypermethylation in circulating blood cells identifies prostate cancer progression.
17954272 2007 Exclusion of APC and VHL gene deletions by array-based comparative hybridization in two patients with microscopically visible chromosomal aberrations.
17952864 2008 Desmoid tumor: a disease opportune for molecular insights.
17947477 2007 High promoter methylation levels of APC predict poor prognosis in sextant biopsies from prostate cancer patients.
17927853 2007 [Expression and significance of APC, beta-catenin, C-myc, and Cyclin D1 proteins in colorectal carcinoma].
17925383 2007 AMER1 regulates the distribution of the tumor suppressor APC between microtubules and the plasma membrane.
17920230 2007 The APC E1317Q and I1307K polymorphisms in non-colorectal cancers.
17910481 2007 Chemical dissection of the APC Repeat 3 multistep phosphorylation by the concerted action of protein kinases CK1 and GSK3.
17905526 2007 Genetic changes of CDH1, APC, and CTNNB1 found in human brain tumors.
17882487 2007 The mutation spectrum of the APC gene in Turkish patients with familial adenomatous polyposis.
17854661 2007 How the I1307K adenomatous polyposis coli gene variant contributes in the assessment of risk of colorectal cancer, but not stomach cancer, in a Turkish population.
17704924 2008 Genetic alterations of APC, K-ras, p53, MSI, and MAGE in Korean colorectal cancer patients.
17665205 2008 Thyroid cancer in two siblings with FAP syndrome and APC mutation.
17653897 2007 May the APC gene somatic mutations in tumor tissues influence the clinical features of Chinese sporadic colorectal cancers?
17620292 2007 Impact of adenomatous polyposis coli (APC) tumor supressor gene in human colon cancer cell lines on cell cycle arrest by apigenin.
17599059 2007 Identification and characterization of Asef2, a guanine-nucleotide exchange factor specific for Rac1 and Cdc42.
17588722 2007 Htid-1, the human homolog of the Drosophila melanogaster l(2)tid tumor suppressor, defines a novel physiological role of APC.
17572842 2007 Adenomatous polyposis coli (APC) plays multiple roles in the intestinal and colorectal epithelia.
17570218 2007 APC inactivation associates with abnormal mitosis completion and concomitant BUB1B/MAD2L1 up-regulation.
17569124 2007 Clinical features of familial adenomas polyps in Chinese and establishment of its immortal lymphocyte cell lines.
17562262 2007 [Methylation status and protein expression of adenomatous polyposis coli (APC) gene in breast cancer].
17562260 2007 [Effect of adenomatous polyposis coli(APC) promoter methylation on gene transcription in lung cancer cell lines].
17558858 2007 Analysis of APC/beta-catenin genes mutations and Wnt signalling pathway in desmoid-type fibromatosis.
17556698 2007 The D1822V APC polymorphism interacts with fat, calcium, and fiber intakes in modulating the risk of colorectal cancer in Portuguese persons.
17510365 2007 Wilms tumor suppressor WTX negatively regulates WNT/beta-catenin signaling.
17506007 2007 A novel frameshift mutation in the APC gene at exon 15 in familial adenomatous polyposis (FAP) with desmoid tumour.
17505512 2007 Investigation of pathogenic mechanisms in multiple colorectal adenoma patients without germline APC or MYH/MUTYH mutations.
17489848 2007 Germline mutations in APC and MUTYH are responsible for the majority of families with attenuated familial adenomatous polyposis.
17486639 2007 Somatic APC mosaicism: a frequent cause of familial adenomatous polyposis (FAP).
17454753 2007 No difference in the occurrence of mismatch repair defects and APC and CTNNB1 genes mutation in a multi-racial colorectal carcinoma patient cohort.
17437043 2007 [Spatial-temporal distribution of glycogen synthase kinase 3beta and adenomatous polyposis coli protein are involved in the injury and repair of airway epithelial cells induced by scratching].
17418091 2007 Axin-independent phosphorylation of APC controls beta-catenin signaling via cytoplasmic retention of beta-catenin.
17411426 2007 Novel APC mutations in Czech and Slovak FAP families: clinical and genetic aspects.
17410430 2007 A splice-site mutation in exon 4 of the APC gene in a family with attenuated familial adenomatous polyposis.
17368237 2007 Genotype-phenotype correlations as a guide in the management of familial adenomatous polyposis.
17360132 2007 Alternative splicing and nonsense-mediated mRNA decay in the regulation of a new adenomatous polyposis coli transcript.
17318191 2007 Bcr-Abl stabilizes beta-catenin in chronic myeloid leukemia through its tyrosine phosphorylation.
17297457 2007 Caspase cleavage of the APC tumor suppressor and release of an amino-terminal domain is required for the transcription-independent function of APC in apoptosis.
17255093 2007 IQ-domain GTPase-activating protein 1 regulates beta-catenin at membrane ruffles and its role in macropinocytosis of N-cadherin and adenomatous polyposis coli.
17252231 2007 MYH, OGG1, MTH1, and APC alterations involved in the colorectal tumorigenesis of Korean patients with multiple adenomas.
17227893 2007 Loss of APC induces polyploidy as a result of a combination of defects in mitosis and apoptosis.
17222366 2007 [Detection and significance of APC gene promoter hypermethylation in serum of breast cancer patients].
17221838 2007 Association of adenomatous polyposis coli (APC) gene polymorphisms with autism spectrum disorder (ASD).
17218255 2007 Modeling of a human circadian mutation yields insights into clock regulation by PER2.
17192415 2007 Lack of adenomatous polyposis coli protein correlates with a decrease in cell migration and overall changes in microtubule stability.
17189293 2007 Truncated APC regulates the transcriptional activity of beta-catenin in a cell cycle dependent manner.
17176113 2006 Mechanism of adenomatous polyposis coli (APC)-mediated blockage of long-patch base excision repair.
17143620 2007 Constitutional high expression of an APC mRNA isoform in a subset of attenuated familial adenomatous polyposis patients.
17143298 2006 Wnt signalling and the actin cytoskeleton.
17135276 2007 APC mutations in FAP-associated desmoid tumours are non-random but not 'just right'.
17126424 2007 Characterization of a 60S complex of the adenomatous polyposis coli tumor suppressor protein.
17119068 2006 APC E1317Q is not associated with Colorectal Cancer in a population-based case-control study in Northern Israel.
17116713 2006 Dietary folate and APC mutations in sporadic colorectal cancer.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17080006 2007 Protein C -1641 AA is associated with decreased survival and more organ dysfunction in severe sepsis.
17039269 2007 Very high incidence of familial colorectal cancer in Newfoundland: a comparison with Ontario and 13 other population-based studies.
17028196 2006 Adenomatous polyposis coli control of C-terminal binding protein-1 stability regulates expression of intestinal retinol dehydrogenases.
16981189 2006 APC gene methylation is inversely correlated with features of the CpG island methylator phenotype in colorectal cancer.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16951153 2006 Smad3 deficiency promotes tumorigenesis in the distal colon of ApcMin/+ mice.
16855398 2006 Genomic instability in precancerous lesions before inactivation of tumor suppressors p53 and APC in patients.
16843107 2006 APC and CTNNB1 mutations are rare in sporadic ependymomas.
16820884 2006 Detection of APC gene deletion by double competitive polymerase chain reaction in patients with familial adenomatous polyposis.
16804979 2006 Deficiency of Adenomatous Polyposis Coli protein in sporadic colorectal adenomas and its associations with clinical phenotype and histology.
16798748 2006 Adenomatous polyposis coli (APC) differentially regulates beta-catenin phosphorylation and ubiquitination in colon cancer cells.
16763565 2006 Misorientation and reduced stretching of aligned sister kinetochores promote chromosome missegregation in EB1- or APC-depleted cells.
16753179 2006 The third 20 amino acid repeat is the tightest binding site of APC for beta-catenin.
16710723 2007 The AAPC case, with an early onset of colorectal cancer.
16699861 2006 Promoter methylation profile in gallbladder cancer.
16699180 2006 The adenomatous polyposis coli tumor suppressor gene regulates expression of cyclooxygenase-2 by a mechanism that involves retinoic acid.
16680592 2006 Mutational analysis of the APC gene in cribriform-morula variant of papillary thyroid carcinoma.
16650078 2006 Novel germline mutations in the APC gene of Cypriot patients with familial and sporadic adenomatous polyposis.
16619216 2006 Hypermethylation of hMLH1, HPP1, p14(ARF), p16(INK4A) and APC in primary adenocarcinomas of the small bowel.
16611247 2006 Human scribble, a novel tumor suppressor identified as a target of high-risk HPV E6 for ubiquitin-mediated degradation, interacts with adenomatous polyposis coli.
16569251 2006 Single nucleotide polymorphisms of the APC gene and colorectal cancer risk: a case-control study in Taiwan.
16545110 2006 Association between cigarette smoking, APC mutations and the risk of developing sporadic colorectal adenomas and carcinomas.
16537703 2006 APC I1307K and the risk of prostate cancer.
16525027 2006 Adenomatous polyposis coli on microtubule plus ends in cell extensions can promote microtubule net growth with or without EB1.
16461775 2006 Disease severity and genetic pathways in attenuated familial adenomatous polyposis vary greatly but depend on the site of the germline mutation.
16450383 2006 Truncated APC is required for cell proliferation and DNA replication.
16433700 2006 Multiple gynecologic tumors as rare associated phenotypes of FAP/Gardner syndrome in a family with the novel germline mutation in the APC gene.
16426911 2006 Microsatellite analysis of the APC gene and immunoexpression of E-cadherin, catenin, and tubulin in esophageal squamous cell carcinoma.
16423286 2006 Examination of actin and microtubule dependent APC localisations in living mammalian cells.
16411234 2006 Familial adenomatous polyposis (FAP): genotype correlation to FAP phenotype with osteomas and sebaceous cysts.
16407829 2006 Alterations of the Wnt signaling pathway during the neoplastic progression of Barrett's esophagus.
16382042 2005 Sulindac sulfone is most effective in modulating beta-catenin-mediated transcription in cells with mutant APC.
16356174 2005 Mutations in APC, CTNNB1 and K-ras genes and expression of hMLH1 in sporadic colorectal carcinomas from the Netherlands Cohort Study.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16344550 2006 Differential use of functional domains by coiled-coil coactivator in its synergistic coactivator function with beta-catenin or GRIP1.
16329837 2005 [Roles of Wnt-1, beta-catenin and adenomatous polyposis coli in the differentiation and proliferation of oral squamous cell carcinoma].
16322291 2005 Promoter hypermethylation as an independent prognostic factor for relapse in patients with prostate cancer following radical prostatectomy.
16293619 2006 Thermodynamics of beta-catenin-ligand interactions: the roles of the N- and C-terminal tails in modulating binding affinity.
16228836 2005 Colorectal polyps in carriers of the APC I1307K polymorphism.
16212417 Biosensor-based micro-affinity purification for the proteomic analysis of protein complexes.
16201232 2005 [Detection of germline mutations in the APC gene with the protein truncation test].
16188939 2005 The adenomatous polyposis coli protein (APC) exists in two distinct soluble complexes with different functions.
16184469 2005 Meat and fish consumption, APC gene mutations and hMLH1 expression in colon and rectal cancer: a prospective cohort study (The Netherlands).
16163548 2005 Mutations of the APC, beta-catenin, and axin 1 genes and cytoplasmic accumulation of beta-catenin in oral squamous cell carcinoma.
16142311 2005 Expression of mucin core proteins, trefoil factors, APC and p21 in subsets of colorectal polyps and cancers suggests a distinct pathway of pathogenesis of mucinous carcinoma of the colorectum.
16088911 2005 Mutation spectrum of the APC gene in 83 Korean FAP families.
16030254 2005 APC and EB1 function together in mitosis to regulate spindle dynamics and chromosome alignment.
15981102 2005 Infrequent mutation of APC, AXIN1, and GSK3B in human pituitary adenomas with abnormal accumulation of CTNNB1.
15959913 2005 Clinical and genetic findings in an Ashkenazi Jewish population with colorectal neoplasms.
15952110 2005 Analysis of germline mutations in the APC gene in familial adenomatous polyposis patients.
15951963 2005 A comparison of the phenotype and genotype in adenomatous polyposis patients with and without a family history.
15943410 2005 APC, K-ras, and p53 gene mutations in colorectal cancer patients: correlation to clinicopathologic features and postoperative surveillance.
15929773 2005 Genetic analyses in consecutive israeli jewish colorectal cancer patients.
15833136 2005 Rare mutations predisposing to familial adenomatous polyposis in Greek FAP patients.
15832580 Analysis of Wnt/Beta catenin signalling in desmoid tumors.
15824157 2005 APC Asp1822Val and Gly2502Ser polymorphisms and risk of colorectal cancer and adenoma.
15821699 2005 Hereditary colon cancer--part I.
15768050 2005 The tumor suppressor adenomatous polyposis coli gene is associated with susceptibility to schizophrenia.
15761860 2005 Mutation analysis of the MYH gene in an Australian series of colorectal polyposis patients with or without germline APC mutations.
15755874 2005 The APC tumor suppressor promotes transcription-independent apoptosis in vitro.
15754020 2005 Status of reduced expression and hypermethylation of the APC tumor suppressor gene in human oral squamous cell carcinoma.
15733272 2005 The I1307K APC mutation in a high-risk clinic setting: a follow-up study.
15689459 2005 Large submicroscopic genomic APC deletions are a common cause of typical familial adenomatous polyposis.
15640937 2004 Influence of diet containing lyophilized Enterococcus faecium M-74 with organic selenium on tumor incidence in Apc1638N mice.
15639864 2003 [The I1307K mutation and protein expression of APC gene in gastric cancer].
15591320 2005 Systematic peptide array-based delineation of the differential beta-catenin interaction with Tcf4, E-cadherin, and adenomatous polyposis coli.
15561772 2004 Truncating APC mutations have dominant effects on proliferation, spindle checkpoint control, survival and chromosome stability.
15548520 2005 Tumor suppressor APC blocks DNA polymerase beta-dependent strand displacement synthesis during long patch but not short patch base excision repair and increases sensitivity to methylmethane sulfonate.
15542524 2004 Evidence for genetic predisposition to desmoid tumours in familial adenomatous polyposis independent of the germline APC mutation.
15540296 2004 APC genotype is not a prognostic factor in familial adenomatous polyposis patients with colorectal cancer.
15523694 2005 Genotype phenotype correlations in Israeli colorectal cancer patients.
15520370 2004 Multiple rare variants in different genes account for multifactorial inherited susceptibility to colorectal adenomas.
15507235 2004 APC gene loss of heterozygosity, mutations, E1317Q, and I1307K germ-line variants in sporadic colon cancer in Croatia.
15459959 2004 Familial adenomatous polyposis: aberrant splicing due to missense or silent mutations in the APC gene.
15446460 2004 [Increased sensitivity for detection of mutations in exon 15 of the APC gene in patients with familial adenomatous polyposis].
15375803 Colorectal cancer prevention.
15355978 2004 Adenomatous polyposis coli is down-regulated by the ubiquitin-proteasome pathway in a process facilitated by Axin.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15331612 2004 Activator protein 2alpha associates with adenomatous polyposis coli/beta-catenin and Inhibits beta-catenin/T-cell factor transcriptional activity in colorectal cancer cells.
15327769 2004 Crystal structure of a beta-catenin/APC complex reveals a critical role for APC phosphorylation in APC function.
15327768 2004 Mechanism of phosphorylation-dependent binding of APC to beta-catenin and its role in beta-catenin degradation.
15326380 2004 APC promoter hypermethylation contributes to the loss of APC expression in colorectal cancers with allelic loss on 5q.
15273719 2004 Isoforms of the APC tumor suppressor and their ability to inhibit cell growth and tumorigenicity.
15266213 APC I1307K and the E1317Q variants are not present in Chinese colorectal cancer patients.
15257316 2004 Analysis of adenomatous polyposis coli gene expression, APC locus-microsatellite instability and APC promoter methylation in the progression of melanocytic tumours.
15251938 2004 Prognostic DNA methylation marker in serum of cancer patients.
15190067 2004 The tumor suppressor adenomatous polyposis coli and caudal related homeodomain protein regulate expression of retinol dehydrogenase L.
15133491 2004 Genetic and epigenetic alterations of the APC gene in malignant melanoma.
15122587 2004 Definition of candidate low risk APC alleles in a Swedish population.
15108288 2004 First genotype characterization of Argentinean FAP patients: identification of 14 novel APC mutations.
15040027 2004 Somatic mutations of APC gene in carcinomas from hereditary non-polyposis colorectal cancer patients.
15020226 2004 MUC1 can interact with adenomatous polyposis coli in breast cancer.
14991743 2004 Crossregulation of NF-kappaB by the APC/GSK-3beta/beta-catenin pathway.
14961559 2003 The mutation spectrum of the APC gene in FAP patients from southern Italy: detection of known and four novel mutations.
14871261 2004 Expression of the proliferating cell nuclear antigen and protein products of tumour suppressor genes in the human foetal testis.
14729851 2004 Novel germline mutations in the adenomatous polyposis coli gene in Polish families with familial adenomatous polyposis.
14728717 2004 N-methyl-N'-nitro-N-nitrosoguanidine-induced senescence-like growth arrest in colon cancer cells is associated with loss of adenomatous polyposis coli protein, microtubule organization, and telomeric DNA.
14691304 2003 APC haploinsufficiency, but not CTNNB1 or CDH1 gene mutations, accounts for a fraction of familial adenomatous polyposis patients without APC truncating mutations.
14679305 2004 Restoration of full-length adenomatous polyposis coli (APC) protein in a colon cancer cell line enhances cell adhesion.
14672538 2003 Role of APC and DNA mismatch repair genes in the development of colorectal cancers.
14662741 2003 Chromosome instability in colorectal tumor cells is associated with defects in microtubule plus-end attachments caused by a dominant mutation in APC.
14624392 2003 Genetic anthropology of the colorectal cancer-susceptibility allele APC I1307K: evidence of genetic drift within the Ashkenazim.
14579148 2004 Inherited variants in MYH are unlikely to contribute to the risk of lung carcinoma.
14578138 2003 The APC E1317Q variant in adenomatous polyps and colorectal cancers.
14578136 2003 The I1307K adenomatous polyposis coli gene variant does not contribute in the assessment of the risk for colorectal cancer in Ashkenazi Jews.
14574158 2003 Genotype and phenotype of patients with both familial adenomatous polyposis and thyroid carcinoma.
14573780 2003 A single nucleotide primer extension assay to detect the APC I1307K gene variant.
14520463 2003 Wnt-signalling pathway in ovarian epithelial tumours: increased expression of beta-catenin and GSK3beta.
14514668 2003 Characterization of functional domains of human EB1 family proteins.
12955080 2003 Nuclear accumulation of full-length and truncated adenomatous polyposis coli protein in tumor cells depends on proliferation.
12952940 2003 Wnt-5a inhibits the canonical Wnt pathway by promoting GSK-3-independent beta-catenin degradation.
12907646 2003 Mutations of APC, K-ras, and p53 are associated with specific chromosomal aberrations in colorectal adenocarcinomas.
12901799 2003 A nonsense mutation in exon 8 of the APC gene (Arg283Ter) causes clinically variable FAP in a Malaysian Chinese family.
12856637 Elevated serum triiodothyronine (t3) in Ashkenazi Jewish prostate cancer patients carrying the I1307k allele of the APC (adenopolyposis coli) gene.
12820959 2003 Structure of a beta-TrCP1-Skp1-beta-catenin complex: destruction motif binding and lysine specificity of the SCF(beta-TrCP1) ubiquitin ligase.
12800196 2003 Epigenetic and genetic alterations of APC and CDH1 genes in lobular breast cancer: relationships with abnormal E-cadherin and catenin expression and microsatellite instability.
12800081 2003 [Expression of members of the cadherin-/catenin-protein family in juvenile angiofibromas].
12737446 2003 Genetic and protein markers related to in situ growth and multiplicity in small sporadic colorectal adenomas.
12655564 2003 Genetic analysis of familial colorectal cancer in Israeli Arabs.
12647217 2003 Expressions of two adenomatous polyposis coli and E-cadherin proteins on human colorectal cancers.
12606575 2003 Nuclear export of the APC tumour suppressor controls beta-catenin function in transcription.
12584179 2003 Dietary factors and the occurrence of truncating APC mutations in sporadic colon carcinomas: a Dutch population-based study.
12581900 2003 Novel mutations of the APC gene in familial adenomatous polyposis in Greek patients.
12575848 2002 Low frequency of beta-catenin gene mutations in pilomatricoma.
12538344 2003 Human DNA methyltransferase gene DNMT1 is regulated by the APC pathway.
12537656 2002 Prevalence of the E1317Q variant of the APC gene in Italian patients with colorectal adenomas.
12508668 2002 Predictive genetic testing: mediators and moderators of anxiety.
12504226 Adenomatous polyposis coli truncation alters cytoskeletal structure and microtubule stability in early intestinal tumorigenesis.
12485844 2002 Structure of the amino-terminal nuclear export domain of the APC tumor suppressor protein.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12439748 2002 Abnormalities of the APC/beta-catenin pathway in endometrial cancer.
12388762 2002 Evidence that an interaction between EB1 and p150(Glued) is required for the formation and maintenance of a radial microtubule array anchored at the centrosome.
12387883 2002 Gut-enriched Krüppel-like factor regulates colonic cell growth through APC/beta-catenin pathway.
12378616 2002 Mutation analysis of APC gene in gastric cancer with microsatellite instability.
12374230 2002 Mutations of the APC gene in human sporadic colorectal cancers.
12173321 2002 Clinical and screening implications of the I1307K adenomatous polyposis coli gene variant in Israeli Ashkenazi Jews with familial colorectal neoplasia. Evidence for a founder effect.
12173026 2002 Pathogenic mutations and rare variants of the APC gene identified in 75 Belgian patients with familial adenomatous polyposis by fluorescent enzymatic mutation detection (EMD).
12163385 2002 Inverse relationship between APC gene mutation in gastric adenomas and development of adenocarcinoma.
12136240 2002 Different familial adenomatous polyposis phenotypes resulting from deletions of the entire APC exon 15.
12124804 2002 Molecular genetic analysis of malignant melanomas for aberrations of the WNT signaling pathway genes CTNNB1, APC, ICAT and BTRC.
12093899 2002 Mutations in APC, Kirsten-ras, and p53--alternative genetic pathways to colorectal cancer.
12072559 2002 Subcellular distribution of Wnt pathway proteins in normal and neoplastic colon.
12070164 2002 The coiled coil region (amino acids 129-250) of the tumor suppressor protein adenomatous polyposis coli (APC). Its structure and its interaction with chromosome maintenance region 1 (Crm-1).
12057910 2002 Mutation cluster region, association between germline and somatic mutations and genotype-phenotype correlation in upper gastrointestinal familial adenomatous polyposis.
12045208 2002 The 'just-right' signaling model: APC somatic mutations are selected based on a specific level of activation of the beta-catenin signaling cascade.
12000790 2002 Axin-mediated CKI phosphorylation of beta-catenin at Ser 45: a molecular switch for the Wnt pathway.
11972058 2002 Association and regulation of casein kinase 2 activity by adenomatous polyposis coli protein.
11955436 2002 Control of beta-catenin phosphorylation/degradation by a dual-kinase mechanism.
11943150 2002 Involvement of the telomeric protein Pin2/TRF1 in the regulation of the mitotic spindle.
11933206 2002 APC germline mutations identified in Czech patients with familial adenomatous polyposis.
11921277 2002 APC/CTNNB1 (beta-catenin) pathway alterations in human prostate cancers.
11920497 2002 The APC/beta-catenin pathway in ulcerative colitis-related colorectal carcinomas: a mutational analysis.
11912492 2002 Identification of a link between the tumour suppressor APC and the kinesin superfamily.
11891193 2002 Genetic and immunohistochemical analysis of pancreatic acinar cell carcinoma: frequent allelic loss on chromosome 11p and alterations in the APC/beta-catenin pathway.
11856748 2002 The androgen receptor can promote beta-catenin nuclear translocation independently of adenomatous polyposis coli.
11720476 2001 Phenotypic characteristics of colo-rectal cancer in I1307K APC germline mutation carriers compared with sporadic cases.
11707392 2001 Molecular mechanisms of beta-catenin recognition by adenomatous polyposis coli revealed by the structure of an APC-beta-catenin complex.
11691822 2001 Human APC2 localization and allelic imbalance.
11606402 2001 Nontruncating APC germ-line mutations and mismatch repair deficiency play a minor role in APC mutation-negative polyposis.
11535846 2001 Relationship between APC genotype, polyp distribution, and oral sulindac treatment in the colon and rectum of patients with familial adenomatous polyposis.
11533658 2001 Pin1 regulates turnover and subcellular localization of beta-catenin by inhibiting its interaction with APC.
11487578 2001 Axin-dependent phosphorylation of the adenomatous polyposis coli protein mediated by casein kinase 1epsilon.
11487538 2001 Polymorphisms and colorectal tumor risk.
11483640 2001 Predictive genetic testing in children and adults: a study of emotional impact.
11470413 2001 Critical role for the EB1 and APC interaction in the regulation of microtubule polymerization.
11466700 2001 The frequency of founder mutations in the BRCA1, BRCA2, and APC genes in Australian Ashkenazi Jews: implications for the generality of U.S. population data.
11425858 2001 Synergistic activation of the Wnt signaling pathway by Dvl and casein kinase Iepsilon.
11409872 2001 Topoisomerase-I- and Alu-mediated genomic deletions of the APC gene in familial adenomatous polyposis.
11389840 2001 Siah-1 mediates a novel beta-catenin degradation pathway linking p53 to the adenomatous polyposis coli protein.
11354631 2001 Carrier rate of APC I1307K is not increased in inflammatory bowel disease patients of Ashkenazi Jewish origin.
11297546 2001 Inhibition of the Wnt signaling pathway by the PR61 subunit of protein phosphatase 2A.
11283619 2001 A role for the Adenomatous Polyposis Coli protein in chromosome segregation.
11241666 2001 Upstream stimulating factor-1 (USF1) and USF2 bind to and activate the promoter of the adenomatous polyposis coli (APC) tumor suppressor gene.
11241320 2001 Genotype and phenotype factors as determinants of desmoid tumors in patients with familial adenomatous polyposis.
11221825 2001 A molecular variant of the APC gene at codon 1822: its association with diet, lifestyle, and risk of colon cancer.
11166179 2001 Binding of the adenomatous polyposis coli protein to microtubules increases microtubule stability and is regulated by GSK3 beta phosphorylation.
11159880 2001 APC I1307K increases risk of transition from polyp to colorectal carcinoma in Ashkenazi Jews.
11157977 2001 Apical membrane localization of the adenomatous polyposis coli tumor suppressor protein and subcellular distribution of the beta-catenin destruction complex in polarized epithelial cells.
11129339 2000 Components of the human spindle checkpoint control mechanism localize specifically to the active centromere on dicentric chromosomes.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11050185 2000 Phosphorylation near nuclear localization signal regulates nuclear import of adenomatous polyposis coli protein.
11035805 2000 Adenomatous polyposis coli protein contains two nuclear export signals and shuttles between the nucleus and cytoplasm.
11029657 2000 The colorectal tumour suppressor APC is present in the NMDA-receptor-PSD-95 complex in the brain.
10982189 2000 Genomic rearrangements of the APC tumor-suppressor gene in familial adenomatous polyposis.
10966653 2000 Hot spots in beta-catenin for interactions with LEF-1, conductin and APC.
10947987 2000 Asef, a link between the tumor suppressor APC and G-protein signaling.
10926498 2000 Crystal structure of the amino-terminal coiled-coil domain of the APC tumor suppressor.
10811618 2000 Structural basis of the Axin-adenomatous polyposis coli interaction.
10782927 2000 A germline mutation at the extreme 3' end of the APC gene results in a severe desmoid phenotype and is associated with overexpression of beta-catenin in the desmoid tumor.
10773885 2000 Regulation and function of the interaction between the APC tumour suppressor protein and EB1.
10749862 2000 Role of the adenomatous polyposis coli gene product in human cardiac development and disease.
10666372 2000 APC mutations in sporadic medulloblastomas.
10656683 2000 The APC-hDLG complex negatively regulates cell cycle progression from the G0/G1 to S phase.
10470088 1999 The type of somatic mutation at APC in familial adenomatous polyposis is determined by the site of the germline mutation: a new facet to Knudson's 'two-hit' hypothesis.
10426194 1999 Loss of heterozygosity and protein expression of APC gene in renal cell carcinomas.
10330403 1999 Domains of axin involved in protein-protein interactions, Wnt pathway inhibition, and intracellular localization.
10188731 1999 EB/RP gene family encodes tubulin binding proteins.
9973276 1999 Inherited colorectal polyposis and cancer risk of the APC I1307K polymorphism.
9950360 1999 Molecular analysis of the APC gene in 205 families: extended genotype-phenotype correlations in FAP and evidence for the role of APC amino acid changes in colorectal cancer predisposition.
9811605 1998 Activation of the human anaphase-promoting complex by proteins of the CDC20/Fizzy family.
9731533 1998 The APCI1307K allele and cancer risk in a community-based study of Ashkenazi Jews.
9731522 1998 The APCI1307K allele and breast cancer risk.
9724771 1998 The APC variants I1307K and E1317Q are associated with colorectal tumors, but not always with a family history.
9707618 1998 A novel frizzled gene identified in human esophageal carcinoma mediates APC/beta-catenin signals.
9660858 1998 The human homologue of Bub3 is required for kinetochore localization of Bub1 and a Mad3/Bub1-related protein kinase.
9637688 1998 The checkpoint protein MAD2 and the mitotic regulator CDC20 form a ternary complex with the anaphase-promoting complex to control anaphase initiation.
9601641 1998 Downregulation of beta-catenin by human Axin and its association with the APC tumor suppressor, beta-catenin and GSK3 beta.
9419979 1997 Drastic genetic instability of tumors and normal tissues in Turcot syndrome.
9375853 1997 APC mutations in familial adenomatous polyposis families in the Northwest of England.
9326658 1997 Binding of high-risk human papillomavirus E6 oncoproteins to the human homologue of the Drosophila discs large tumor suppressor protein.
9286858 1997 DAP-1, a novel protein that interacts with the guanylate kinase-like domains of hDLG and PSD-95.
9188857 1997 Cloning and characterization of NE-dlg: a novel human homolog of the Drosophila discs large (dlg) tumor suppressor protein interacts with the APC protein.
9110174 1997 Large-scale concatenation cDNA sequencing.
8990002 1997 Molecular analysis of the APC gene in 105 Dutch kindreds with familial adenomatous polyposis: 67 germline mutations identified by DGGE, PTT, and southern analysis.
8940264 1996 Hereditary desmoid disease due to a frameshift mutation at codon 1924 of the APC gene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8764128 1996 Somatic mutations of the APC gene in sporadic hepatoblastomas.
8638126 1996 Binding of GSK3beta to the APC-beta-catenin complex and regulation of complex assembly.
8638125 1996 Binding of APC to the human homolog of the Drosophila discs large tumor suppressor protein.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8521819 1995 The tumour suppressor gene product APC blocks cell cycle progression from G0/G1 to S phase.
8383094 1993 Identification of an alternative 5' untranslated region of the adenomatous polyposis coli gene.
8259519 1993 Association of the APC tumor suppressor protein with catenins.
8259518 1993 Association of the APC gene product with beta-catenin.
8252630 1993 Alleles of the APC gene: an attenuated form of familial polyposis.
8111410 1993 Mutations of the APC (adenomatous polyposis coli) gene.
7890674 1995 The APC protein and E-cadherin form similar but independent complexes with alpha-catenin, beta-catenin, and plakoglobin.
7833931 1994 Four novel mutations of the APC (adenomatous polyposis coli) gene in FAP patients.
7833149 1994 Mutational analysis of the first 14 exons of the adenomatous polyposis coli (APC) gene.
7806582 1994 E-cadherin and APC compete for the interaction with beta-catenin and the cytoskeleton.
7744883 1995 A 77-kDa protein associates with pp125FAK in mast cells and becomes tyrosine-phosphorylated by high affinity IgE receptor aggregation.
7661930 1995 The molecular basis of Turcot's syndrome.
3789010 1986 Gardner syndrome in a man with an interstitial deletion of 5q.
2797819 1989 High frequency of APC loss in sporadic colorectal carcinoma due to breaks clustered in 5q21-22.
1678319 1991 Identification of deletion mutations and three new genes at the familial polyposis locus.
1651563 1991 Mutations of chromosome 5q21 genes in FAP and colorectal cancer patients.
1651562 1991 Identification of FAP locus genes from chromosome 5q21.
1338904 1992 Somatic mutations of the APC gene in colorectal tumors: mutation cluster region in the APC gene.
1338764 1992 Screening for germ-line mutations in familial adenomatous polyposis patients: 61 new patients and a summary of 150 unrelated patients.
1338691 1992 Somatic mutation of the APC gene in gastric cancer: frequent mutations in very well differentiated adenocarcinoma and signet-ring cell carcinoma.
1310068 1992 Disruption of the APC gene by a retrotransposal insertion of L1 sequence in a colon cancer.