Property Summary

NCBI Gene PubMed Count 15
PubMed Score 1.23
PubTator Score 1.72

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.200 4.0e-04
ulcerative colitis -1.500 1.4e-04
ovarian cancer -1.300 8.5e-08

Gene RIF (3)

PMID Text
20966410 Observational study of gene-disease association. (HuGE Navigator)
20012524 In the absence of Vpu, Env accumulates extensively within clathrin-coated endosomal structures, including the viral proteins Gag and MA; the tetraspanins CD63 and CD81; the adaptor protein complex AP-3; and AIP1/ALIX, a cellular cofactor for viral budding
18076669 In the absence of Vpu, Env accumulates extensively within clathrin-coated endosomal structures, including the viral proteins Gag and MA; the tetraspanins CD63 and CD81; the adaptor protein complex AP-3; and AIP1/ALIX, a cellular cofactor for viral budding

AA Sequence

MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLIYRHYAT      1 - 70
LYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGMVLETNMNEIVAQ     71 - 140
IEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQFV                     141 - 193
//

Text Mined References (16)

PMID Year Title
24509480 2014 Genome-wide trans-ancestry meta-analysis provides insight into the genetic architecture of type 2 diabetes susceptibility.
23945395 2014 Genome-wide association study identifies three novel loci for type 2 diabetes.
21874001 2011 Genome-wide association study in individuals of South Asian ancestry identifies six new type 2 diabetes susceptibility loci.
20966410 2010 Genomewide linkage and peakwide association analyses of carotid plaque in Caribbean Hispanics.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469849 2004 An ear-core interaction regulates the recruitment of the AP-3 complex to membranes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12967569 2003 Specific regulation of the adaptor protein complex AP-3 by the Arf GAP AGAP1.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12019270 2002 BLOC-1, a novel complex containing the pallidin and muted proteins involved in the biogenesis of melanosomes and platelet-dense granules.
11907283 2002 Role of adaptor complex AP-3 in targeting wild-type and mutated CD63 to lysosomes.
9182526 1997 Beta3A-adaptin, a subunit of the adaptor-like complex AP-3.
9118953 1997 AP-3: an adaptor-like protein complex with ubiquitous expression.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.