Property Summary

NCBI Gene PubMed Count 18
PubMed Score 27.21
PubTator Score 21.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -2.100 3.7e-02
cutaneous lupus erythematosus 2.200 4.2e-04
head and neck cancer and chronic obstruc... 1.100 3.4e-04
interstitial cystitis 1.400 2.3e-03
lung carcinoma -2.000 7.5e-20
mucosa-associated lymphoid tissue lympho... 1.152 2.8e-02
osteosarcoma -2.541 7.7e-04
tuberculosis 1.900 4.9e-07

Gene RIF (6)

AA Sequence

MQSPWKILTVAPLFLLLSLQSSASPANDDQSRPSLSNGHTCVGCVLVVSVIEQLAQVHNSTVQASMERLC      1 - 70
SYLPEKLFLKTTCYLVIDKFGSDIIKLLSADMNADVVCHTLEFCKQNTGQPLCHLYPLPKETWKFTLQKA     71 - 140
RQIVKKSPILKYSRSGSDICSLPVLAKICQKIKLAMEQSVPFKDVDSDKYSVFPTLRGYHWRGRDCNDSD    141 - 210
ESVYPGRRPNNWDVHQDSNCNGIWGVDPKDGVPYEKKFCEGSQPRGIILLGDSAGAHFHISPEWITASQM    211 - 280
SLNSFINLPTALTNELDWPQLSGATGFLDSTVGIKEKSIYLRLWKRNHCNHRDYQNISRNGASSRNLKKF    281 - 350
IESLSRNKVLDYPAIVIYAMIGNDVCSGKSDPVPAMTTPEKLYSNVMQTLKHLNSHLPNGSHVILYGLPD    351 - 420
GTFLWDNLHNRYHPLGQLNKDMTYAQLYSFLNCLQVSPCHGWMSSNKTLRTLTSERAEQLSNTLKKIAAS    421 - 490
EKFTNFNLFYMDFAFHEIIQEWQKRGGQPWQLIEPVDGFHPNEVALLLLADHFWKKVQLQWPQILGKENP    491 - 560
FNPQIKQVFGDQGGH                                                           561 - 575
//

Text Mined References (21)

PMID Year Title