Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.34
PubTator Score 9.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Atopic dermatitis -1.600 2.6e-04
Breast cancer 1.100 1.5e-03
breast carcinoma 1.300 5.7e-05
colon cancer 2.600 4.0e-02
ductal carcinoma in situ 1.800 3.0e-02
esophageal adenocarcinoma -1.600 2.9e-02
interstitial cystitis -1.500 4.0e-02
intraductal papillary-mucinous adenoma (... -1.800 1.2e-03
intraductal papillary-mucinous carcinoma... -1.200 9.4e-03
lung cancer 2.500 9.5e-04
nasopharyngeal carcinoma -1.500 6.2e-04
ovarian cancer -2.400 2.1e-12
pituitary cancer 1.400 2.0e-03
psoriasis 1.300 5.5e-04
spina bifida -2.231 4.1e-02

Synonym

Accession O76027 Q5SZF1 Q6FI55 Q9BS00 Q9HBJ6
Symbols ANX31

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MSVTGGKMAPSLTQEILSHLGLASKTAAWGTLGTLRTFLNFSVDKDAQRLLRAITGQGVDRSAIVDVLTN      1 - 70
RSREQRQLISRNFQERTQQDLMKSLQAALSGNLERIVMALLQPTAQFDAQELRTALKASDSAVDVAIEIL     71 - 140
ATRTPPQLQECLAVYKHNFQVEAVDDITSETSGILQDLLLALAKGGRDSYSGIIDYNLAEQDVQALQRAE    141 - 210
GPSREETWVPVFTQRNPEHLIRVFDQYQRSTGQELEEAVQNRFHGDAQVALLGLASVIKNTPLYFADKLH    211 - 280
QALQETEPNYQVLIRILISRCETDLLSIRAEFRKKFGKSLYSSLQDAVKGDCQSALLALCRAEDM         281 - 345
//

Text Mined References (17)

PMID Year Title