Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.87
PubTator Score 14.52

Knowledge Summary


No data available



  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.500 1.0e-06
psoriasis 1.400 1.6e-04
tuberculosis 1.300 3.1e-07
pituitary cancer -1.400 4.0e-04

Gene RIF (6)

25730773 ANO10 has a central role in innate immune defense against Borrelia infection.
25182700 The detection of mutations in ANO10 indicate that ANO10 defects cause secondary low coenzyme Q10.
25089919 An ANO10 mutation is responsible for autosomal recessive cerebellar ataxia that is mainly characterized by cerebellar atrophy and lack of peripheral neuropathy.
24275721 Whole-exome and targeted sequencing have defined the genetic basis of dizziness including new genes causing ataxia: GBA2, TGM6, ANO10 and SYT14
22527681 New DNA sequencing technologies are enabling us to investigate the whole or large targeted proportions of the genome in a rapid, affordable, and comprehensive way. Exome and targeted sequencing ANO10 genes causing ataxia.
22008874 This study report Gypsy family with autosomal recessive ataxia caused by the same truncating ANO10 defect.

AA Sequence

SLEALKQQQMKLVTENLKEEPMESGKEKAT                                            631 - 660

Text Mined References (30)

PMID Year Title
27227820 2016 Role of Ca(2+) in the Stability and Function of TMEM16F and 16K.
27045840 2016 Executive and Attentional Disorders, Epilepsy and Porencephalic Cyst in Autosomal Recessive Cerebellar Ataxia Type 3 Due to ANO10 Mutation.
26811235 2016 Cellular functions of TMEM16/anoctamin.
25730773 2015 A Coding Variant of ANO10, Affecting Volume Regulation of Macrophages, Is Associated with Borrelia Seropositivity.
25664551 2015 Autosomal recessive cerebellar ataxia 3 due to homozygote c.132dupA mutation within the ANO10 gene--reply.
25182700 2014 ANO10 mutations cause ataxia and coenzyme Q?? deficiency.
25089919 2014 Autosomal recessive cerebellar ataxia type 3 due to ANO10 mutations: delineation and genotype-phenotype correlation study.
24692353 2014 Structure and function of TMEM16 proteins (anoctamins).
24275721 2014 Genetics of dizziness: cerebellar and vestibular disorders.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22946059 2012 Anoctamins are a family of Ca2+-activated Cl- channels.
22527681 2012 Recent advances in the genetics of cerebellar ataxias.
22302790 2012 The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age.
22075693 2012 ANOs 3-7 in the anoctamin/Tmem16 Cl- channel family are intracellular proteins.
22008874 2012 ANO10 c.1150_1151del is a founder mutation causing autosomal recessive cerebellar ataxia in Roma/Gypsies.
21984732 2012 The anoctamin family: TMEM16A and TMEM16B as calcium-activated chloride channels.
21642943 2011 Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?
21607626 2011 Anoctamins.
21092923 2010 Targeted next-generation sequencing of a 12.5 Mb homozygous region reveals ANO10 mutations in patients with autosomal-recessive cerebellar ataxia.
20964844 2010 Evolution and functional divergence of the anoctamin family of membrane proteins.
20056604 2010 Expression and function of epithelial anoctamins.
19946888 2010 Defining the membrane proteome of NK cells.
19015192 2009 Anoctamin/TMEM16 family members are Ca2+-activated Cl- channels.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16211264 2005 Phylogeny of the TMEM16 protein family: some members are overexpressed in cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.