Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.79
PubTator Score 5.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.755 2.9e-04
tuberculosis 1.500 1.7e-02
group 3 medulloblastoma -1.800 8.0e-03
pilocytic astrocytoma 1.700 1.4e-03

 Compartment GO Term (1)

Gene RIF (4)

PMID Text
23457408 ANKRD55 rs459193 and GRB14 rs13389219 associate with insulin resistance.
23315543 Performed a genome-wide significant association study of ANKRD55 rs6859219 and multiple sclerosis risk. Genotyped ANKRD55 rs6859219 in 5106 MS cases and 3740 healthy control subjects.
22130326 ANKRD55 and DHCR7 are novel multiple sclerosis risk loci.
20080650 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MMRQATMDFSTPSVFDQQRGDSSEEVDLTMVYQAASNGDVNALTAVIREDPSILECCDSEGCTPLMHAVS      1 - 70
GRQADTVKLLLKMGANINMQDAYGRTSLCLATYLGWLEGCVSLLRNGAKHNIPDKNGRLPLHAATAEPDM     71 - 140
RLLTVLLQQSNISEINHQDNEGMTPLHWAAFHNQPQHTQMLLKKGADPTLVDKDFKTALHWAVQSGNRIL    141 - 210
CSIILSHHQGPSIINYDDESGKTCVHIAAAAGFSDIIHELARVPECNLQALDVDDRTPLHWAAAAGKAEC    211 - 280
VQSLLELGMDSNLRDINESTPLAYALYCGHTACVKLLSQESRTEPTRPPPSQSSRPQKKERRFNVLNQIF    281 - 350
CKNKKEEQRAHQKDPSRDRYREEDTSEVNDIITTFDSIVGTNCQEQPGDQVAMVEFKKKTSDNSKYLLPE    351 - 420
KKPLARKGLPPIRTQSLPPITLGNNFLTASHRATSHAGLSSAPHHMAQRSQKSRSEQDLLNNRTGCQMLL    421 - 490
DNPWKSDSNQVFSYKVWTVSSSDKLLDRLLSVRPGHQEVSVPPHLRHLHNPSSGQNFQHLSPNRHKIRDL    491 - 560
PFTRNNLAPLPDQKFLSGEPLRTNRVLPAIPSQRRHSTAAEESEHSANPTSDEN                    561 - 614
//

Text Mined References (18)

PMID Year Title
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
23457408 2013 Type 2 diabetes risk alleles near BCAR1 and in ANK1 associate with decreased ?-cell function whereas risk alleles near ANKRD55 and GRB14 associate with decreased insulin sensitivity in the Danish Inter99 cohort.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23315543 2013 Genome-wide significant association of ANKRD55 rs6859219 and multiple sclerosis risk.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22130326 2012 ANKRD55 and DHCR7 are novel multiple sclerosis risk loci.
21383967 2011 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
20080650 2010 Inherited genetic variant predisposes to aggressive but not indolent prostate cancer.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.