Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
chronic rhinosinusitis -1.253 2.7e-02
cystic fibrosis and chronic rhinosinusit... -1.267 4.4e-02
ependymoma 2.200 1.6e-09

 Compartment GO Term (1)

AA Sequence

MVTEEAGARVWVFLELMESEGPPESESSEFFSQQEEENEEEEAQEPEETGPKNPLLQPALTGDVEGLQKI      1 - 70
FEDPENPHHEQAMQLLLEEDIVGRNLLYAACMAGQSDVIRALAKYGVNLNEKTTRGYTLLHCAAAWGRLE     71 - 140
TLKALVELDVDIEALNFREERARDVAARYSQTECVEFLDWADARLTLKKYIAKVSLAVTDTEKGSGKLLK    141 - 210
EDKNTILSACRAKNEWLETHTEASINELFEQRQQLEDIVTPIFTKMTTPCQVKSAKSVTSHDQKRSQDDT    211 - 280
SN                                                                        281 - 282
//

Text Mined References (5)

PMID Year Title