Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.61
PubTator Score 0.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Rheumatoid Arthritis 1.700 3.2e-03
osteosarcoma -1.524 1.1e-05
atypical teratoid / rhabdoid tumor -1.100 3.1e-02
primitive neuroectodermal tumor 1.200 8.5e-03
tuberculosis and treatment for 3 months 1.300 3.4e-07
non-small cell lung cancer -1.908 4.3e-17
intraductal papillary-mucinous carcinoma... -1.100 4.5e-02
sarcoidosis 1.400 4.8e-03
interstitial cystitis 1.500 4.8e-03
adult high grade glioma 1.100 1.1e-02
pilocytic astrocytoma 1.300 9.1e-04
primary Sjogren syndrome 2.000 1.8e-04
invasive ductal carcinoma 1.244 8.8e-05
lung carcinoma -1.800 4.5e-25
progressive supranuclear palsy -1.100 4.4e-02
ulcerative colitis 2.000 2.8e-04
ovarian cancer -2.300 1.2e-04
head and neck cancer -1.400 4.8e-04

 Compartment GO Term (2)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVLKLTDQPPLVQAIFSGDPEEIRMLIHKTEDVNTLDSEKRTPLHVAAFLGDAEIIELLILSGARVNAK      1 - 70
DNMWLTPLHRAVASRSEEAVQVLIKHSADVNARDKNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGG     71 - 140
RTALHHAALNGHVEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPL    141 - 210
HAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNNGFTPLHFAA    211 - 280
ASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGNTPLHVAARYG    281 - 350
HELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGFEIDTPDKFGRTCLHAAAAGGNVEC    351 - 420
IKLLQSSGADFHKKDKCGRTPLHYAAANCHFHCIETLVTTGANVNETDDWGRTALHYAAASDMDRNKTIL    421 - 490
GNAHDNSEELERARELKEKEATLCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNSGFE    491 - 560
ESDSGATKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALDLAAFKGHTECVEALINQGASIFVKD    561 - 630
NVTKRTPLHASVINGHTLCLRLLLEIADNPEAVDVKDAKGQTPLMLAVAYGHIDAVSLLLEKEANVDTVD    631 - 700
ILGCTALHRGIMTGHEECVQMLLEQEVSILCKDSRGRTPLHYAAARGHATWLSELLQMALSEEDCCFKDN    701 - 770
QGYTPLHWACYNGNENCIEVLLEQKCFRKFIGNPFTPLHCAIINDHGNCASLLLGAIDSSIVSCRDDKGR    771 - 840
TPLHAAAFADHVECLQLLLRHSAPVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPL    841 - 910
HLACSKGHEKCALLILDKIQDESLINEKNNALQTPLHVAARNGLKVVVEELLAKGACVLAVDENASRSNG    911 - 980
PRSTPGTAVQKEE                                                             981 - 993
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24962325 2014 Genome-wide survival analysis of age at onset of alcohol dependence in extended high-risk COGA families.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
21269460 2011 Initial characterization of the human central proteome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
18186651 2008 Protein phosphatase 6 regulatory subunits composed of ankyrin repeat domains.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16555005 2006 The Tre2 oncoprotein, implicated in Ewing's sarcoma, interacts with two components of the cytoskeleton.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.