Property Summary

NCBI Gene PubMed Count 19
PubMed Score 22.94
PubTator Score 29.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
THROMBOCYTOPENIA 2 (disorder) 2
Disease Target Count P-value
malignant mesothelioma 3163 2.0e-07
lung cancer 4473 3.8e-03
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
Thrombocytopenia 2 2

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 2.100 2.0e-07
lung cancer 1.300 3.8e-03

Gene RIF (10)

PMID Text
26175287 WASP, RUNX1, and ANKRD26 genes are important for normal TPO signaling and the network underlying thrombopoiesis.
25902755 thrombocytopenia with 5'UTR ANKRD26 gene mutation must be considered in case of a constitutional isolated thrombocytopenia, with a low bleeding tendency, associated with autosomal dominant transmission and normal platelet volume.
24628296 The study supports the association of ANKRD26 mutations with thrombocytopenia 2 and a predisposition to myeloid malignancies.
24430186 ANKRD26 regulatory region mutations induce MAPK hyperactivation in familial thrombocytopenia
24030261 Studies indicate that ANKRD26-RT is an insidious form of inherited thrombocytopenias that exposes patients to a low risk of bleeding but predisposes them to hematologic myeloid malignancies.
23869080 the missense mutations may paly a role in the pathogenesis of Autosomal-dominant nonsyndromic thrombocytopenia-2
23223974 Ubiquitin/proteasome-rich particulate cytoplasmic structures are a characteristic feature of ANKRD26-related thrombocytopenia platelets and megakaryocytes.
21467542 The ANKRD26-related thrombocytopenia has to be taken into consideration in the differential diagnosis of isolated thrombocytopenias.
21211618 mutations in the 5' UTR of ANKRD26 are implicated in thrombocytopenia 2.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKKIFSKKGESPLGSFARRQRSSAGGGGEPGEGAYSQPGYHVRDRDLGKIHKAASAGNVAKVQQILLLRK      1 - 70
NGLNDRDKMNRTALHLACANGHPEVVTLLVDRKCQLNVCDNENRTALMKAVQCQEEKCATILLEHGADPN     71 - 140
LADVHGNTALHYAVYNEDISVATKLLLYDANIEAKNKDDLTPLLLAVSGKKQQMVEFLIKKKANVNAVDK    141 - 210
LESSHQLISEYKEERIPKHSSQNSNSVDESSEDSLSRLSGKPGVDDSWPTSDDEDLNFDTKNVPKPSLAK    211 - 280
LMTASQQSRKNLEATYGTVRTGNRTLFEDRDSDSQDEVVVESLPTTSIKVQCFSHPTYQSPDLLPKPSHK    281 - 350
SLANPGLMKEEPTKPGIAKKENGIDIIESAPLEQTNNDNLTYVDEVHKNNRSDMMSALGLGQEEDIESPW    351 - 420
DSESISENFPQKYVDPLAGAADGKEKNIGNEQAEDVFYIPSCMSGSRNFKMAKLEDTRNVGMPVAHMESP    421 - 490
ERYLHLKPTIEMKDSVPNKAGGMKDVQTSKAAEHDLEVASEEEQEREGSENNQPQVEEERKKHRNNEMEV    491 - 560
SANIHDGATDDAEDDDDDDGLIQKRKSGETDHQQFPRKENKEYASGPALQMKEVKSTEKEKRTSKESVNS    561 - 630
PVFGKASLLTGGLLQVDDDSSLSEIDEDEGRPTKKTSNEKNKVKNQIQSMDDVDDLTQSSETASEDCELP    631 - 700
HSSYKNFMLLIEQLGMECKDSVSLLKIQDAALSCERLLELKKNHCELLTVKIKKMEDKVNVLQRELSETK    701 - 770
EIKSQLEHQKVEWERELCSLRFSLNQEEEKRRNADTLYEKIREQLRRKEEQYRKEVEVKQQLELSLQTLE    771 - 840
MELRTVKSNLNQVVQERNDAQRQLSREQNARMLQDGILTNHLSKQKEIEMAQKKMNSENSHSHEEEKDLS    841 - 910
HKNSMLQEEIAMLRLEIDTIKNQNQEKEKKCFEDLKIVKEKNEDLQKTIKQNEETLTQTISQYNGRLSVL    911 - 980
TAENAMLNSKLENEKQSKERLEAEVESYHSRLAAAIHDRDQSETSKRELELAFQRARDECSRLQDKMNFD    981 - 1050
VSNLKDNNEILSQQLFKTESKLNSLEIEFHHTRDALREKTLGLERVQKDLSQTQCQMKEMEQKYQNEQVK   1051 - 1120
VNKYIGKQESVEERLSQLQSENMLLRQQLDDAHNKADNKEKTVINIQDQFHAIVQKLQAESEKQSLLLEE   1121 - 1190
RNKELISECNHLKERQYQYENEKAEREVVVRQLQQELADTLKKQSMSEASLEVTSRYRINLEDETQDLKK   1191 - 1260
KLGQIRNQLQEAQDRHTEAVRCAEKMQDHKQKLEKDNAKLKVTVKKQMDKIEELQKNLLNANLSEDEKEQ   1261 - 1330
LKKLMELKQSLECNLDQEMKKNVELEREITGFKNLLKMTRKKLNEYENGEFSFHGDLKTSQFEMDIQINK   1331 - 1400
LKHKIDDLTAELETAGSKCLHLDTKNQILQEELLSMKTVQKKCEKLQKNKKKLEQEVINLRSHIERNMVE   1401 - 1470
LGQVKQYKQEIEERARQEIAEKLKEVNLFLQAQAASQENLEQFRENNFASMKSQMELRIKDLESELSKIK   1471 - 1540
TSQEDFNKTELEKYKQLYLEELKVRKSLSSKLTKTNERLAEVNTKLLVEKQQSRSLFTTLTTRPVMEPPC   1541 - 1610
VGNLNNSLDLNRKLIPRENLVISTSNPRASNNSMENYLSKMQQELEKNITRELKEAAAELESGSIASPLG   1611 - 1680
STDESNLNQDLVWKASREYVQVLKKNYMI                                            1681 - 1709
//

Text Mined References (24)

PMID Year Title
26175287 2015 Analyses of Genetic and Clinical Parameters for Screening Patients With Inherited Thrombocytopenia with Small or Normal-Sized Platelets.
25902755 2015 Childhood diagnosis of genetic thrombocytopenia with mutation in the ankyrine repeat domain 26 gene.
24628296 2014 A new family with a germline ANKRD26 mutation and predisposition to myeloid malignancies.
24430186 2014 Thrombocytopenia-associated mutations in the ANKRD26 regulatory region induce MAPK hyperactivation.
24030261 2013 ANKRD26-related thrombocytopenia and myeloid malignancies.
23869080 2013 A missense mutation in ANKRD26 segregates with thrombocytopenia.
23223974 2013 Ubiquitin/proteasome-rich particulate cytoplasmic structures (PaCSs) in the platelets and megakaryocytes of ANKRD26-related thrombo-cytopenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21467542 2011 Mutations in ANKRD26 are responsible for a frequent form of inherited thrombocytopenia: analysis of 78 patients from 21 families.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21211618 2011 Mutations in the 5' UTR of ANKRD26, the ankirin repeat domain 26 gene, cause an autosomal-dominant form of inherited thrombocytopenia, THC2.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16364570 2006 Duplication and extensive remodeling shaped POTE family genes encoding proteins containing ankyrin repeat and coiled coil domains.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10470851 1999 Prediction of the coding sequences of unidentified human genes. XIV. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.