Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.69
PubTator Score 8.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.3e-10
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 3.0
ovarian cancer 8520 0.0 2.7
Disease Target Count Z-score Confidence
Patellofemoral pain syndrome 10 4.303 2.2

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -4.852 1.3e-10

 IMPC Phenotype (1)

 MGI Phenotype (1)

Gene RIF (7)

AA Sequence

MCSEARLARRLRDALREEEPWAVEELLRCGADPNLVLEDGAAAVHLAAGARHPRGLRCLGALLRQGGDPN      1 - 70
ARSVEALTPLHVAAAWGCRRGLELLLSQGADPALRDQDGLRPLDLALQQGHLECARVLQDLDTRTRTRTR     71 - 140
IGAETQEPEPAPGTPGLSGPTDETLDSIALQKQPCRGDNRDIGLEADPGPPSLPVPLETVDKHGSSASPP    141 - 210
GHWDYSSDASFVTAVEVSGAEDPASDTPPWAGSLPPTRQGLLHVVHANQRVPRSQGTEAELNARLQALTL    211 - 280
TPPNAAGFQSSPSSMPLLDRSPAHSPPRTPTPGASDCHCLWEHQTSIDSDMATLWLTEDEASSTGGREPV    281 - 350
GPCRHLPVSTVSDLELLKGLRALGENPHPITPFTRQLYHQQLEEAQIAPGPEFSGHSLELAAALRTGCIP    351 - 420
DVQADEDALAQQFEQPDPARRWREGVVKSSFTYLLLDPRETQDLPARAFSLTPAERLQTFIRAIFYVGKG    421 - 490
TRARPYVHLWEALGHHGRSRKQPHQACPKVRQILDIWASGCGVVSLHCFQHVVAVEAYTREACIVEALGI    491 - 560
QTLTNQKQGHCYGVVAGWPPARRRRLGVHLLHRALLVFLAEGERQLHPQDIQARG                   561 - 615
//

Text Mined References (14)

PMID Year Title