Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.22
PubTator Score 1.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.2e-07
psoriasis 6694 1.8e-04
astrocytoma 1146 6.3e-03

Expression

  Differential Expression (3)

Disease log2 FC p
astrocytoma -1.200 6.3e-03
osteosarcoma -2.111 1.2e-07
psoriasis -1.200 1.8e-04

Gene RIF (2)

AA Sequence

MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDD      1 - 70
EDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI                        71 - 121
//

Text Mined References (14)

PMID Year Title