Property Summary

NCBI Gene PubMed Count 26
PubMed Score 18.08
PubTator Score 13.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.8e-04
ovarian cancer 8520 6.3e-04
psoriasis 6694 3.5e-03

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.400 1.8e-04
ovarian cancer -1.100 6.3e-04
psoriasis -1.100 3.5e-03

Synonym

Accession Q9UM13 D3DNZ7 Q2V500 Q9UG51 Q9Y5R0 APC10
Symbols DOC1
APC10

Gene

PANTHER Protein Class (1)

PDB

4UI9   5A31   5G04   5G05   5KHR   5KHU   5L9T   5L9U   5LCW   1JHJ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRR      1 - 70
KTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIA     71 - 140
VLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR                             141 - 185
//

Text Mined References (29)

PMID Year Title