Property Summary

NCBI Gene PubMed Count 26
PubMed Score 18.08
PubTator Score 13.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.8e-04
ovarian cancer 8520 6.3e-04
psoriasis 6694 3.5e-03

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell -1.400 1.8e-04
ovarian cancer -1.100 6.3e-04
psoriasis -1.100 3.5e-03

PDB (10)

Gene RIF (2)

AA Sequence

MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRR      1 - 70
KTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIA     71 - 140
VLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR                             141 - 185
//

Text Mined References (29)

PMID Year Title