1. Home
  2. Targets
  3. enzyme modulator
  4. Anaphase-promoting complex subunit 10

Tbio Anaphase-promoting complex subunit 10

Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains.

ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1 (CDK1; MIM 116940) (summary by Wendt et al., 2001 [PubMed 11524682]).[supplied by OMIM, Feb 2011]

 Comments

Property Summary

NCBI Gene PubMed Count 26
PubMed Score 18.06
PubTator Score 13.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
medulloblastoma, large-cell 6234 1.8e-04
ovarian cancer 8491 2.5e-04
psoriasis 6685 3.5e-03

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.100 3.5e-03
medulloblastoma, large-cell -1.400 1.8e-04
ovarian cancer 1.200 2.5e-04

Synonym

Accession Q9UM13 D3DNZ7 Q2V500 Q9UG51 Q9Y5R0 APC10
Symbols DOC1
APC10

Gene

ANAPC10

PANTHER Protein Class (1)

PDB

4UI9   5A31   5G04   5G05   5KHR   5LCW   1JHJ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 UniProt Keyword (9)

 GO Component (3)

 GO Process (11)

See all...

 Compartment GO Term (30)

See all...

 GWAS Trait (1)

 HCA RNA Cell Line (56)

See all...

Pathway (39)

See all...

Protein-protein Interaction (21)

CDK1   UBB   UBC   CCNB1   CDK2   CDC25A   CDC25B   CDC25C   CDK7   CCNH   NEK2   ANAPC15   CDC20   CDC16   MAD2L1   SKP2   CDC26   ANAPC16   ANAPC13   CDC23   FZR1  

Gene RIF (2)

PMID Text
21336306 Cdc20 requires APC3 and APC8 to bind and activate the APC/C when the spindle assembly checkpoint is satisfied, but only APC8 when active, and APC10 is crucial for the destruction of cyclin B1 and securin, but not cyclin A
21186364 Substrates are recruited to the Anaphase-promoting complex by binding to a bipartite substrate receptor composed of Cdh1 and Doc1.

AA Sequence 

MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRR      1 - 70
KTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIA     71 - 140
VLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR                             141 - 185
//

Text Mined References (29)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21926987 2011 APC15 drives the turnover of MCC-CDC20 to make the spindle assembly checkpoint responsive to kinetochore attachment.
21336306 2011 How APC/C-Cdc20 changes its substrate specificity in mitosis.
21186364 2011 Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
16364912 2005 Localization of the coactivator Cdh1 and the cullin subunit Apc2 in a cryo-electron microscopy model of vertebrate APC/C.
15489335 2004 Human ORFeome version 1.1: a platform for reverse proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15144564 2004 Direct interaction between Smad3, APC10, CDH1 and HEF1 in proteasomal degradation of HEF1.
15029244 2004 Mammalian Cdh1/Fzr mediates its own degradation.
14593737 2003 The mitotic checkpoint: a signaling pathway that allows a single unattached kinetochore to inhibit mitotic exit.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12070128 2002 Human securin proteolysis is controlled by the spindle checkpoint and reveals when the APC/C switches from activation by Cdc20 to Cdh1.
11742988 2001 APC/C-mediated destruction of the centrosomal kinase Nek2A occurs in early mitosis and depends upon a cyclin A-type D-box.
11535616 2001 Checkpoint inhibition of the APC/C in HeLa cells is mediated by a complex of BUBR1, BUB3, CDC20, and MAD2.
11524682 2001 Crystal structure of the APC10/DOC1 subunit of the human anaphase-promoting complex.
11340163 2001 A conserved cyclin-binding domain determines functional interplay between anaphase-promoting complex-Cdh1 and cyclin A-Cdk2 during cell cycle progression.
11285280 2001 Anaphase-promoting complex/cyclosome-dependent proteolysis of human cyclin A starts at the beginning of mitosis and is not subject to the spindle assembly checkpoint.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10922056 2000 The RING-H2 finger protein APC11 and the E2 enzyme UBC4 are sufficient to ubiquitinate substrates of the anaphase-promoting complex.
10827173 2000 Interactions of the low density lipoprotein receptor gene family with cytosolic adaptor and scaffold proteins suggest diverse biological functions in cellular communication and signal transduction.
10793135 2000 Mitotic regulation of the APC activator proteins CDC20 and CDH1.
10548110 1999 Accumulation of cyclin B1 requires E2F and cyclin-A-dependent rearrangement of the anaphase-promoting complex.
10498862 1999 Identification of human APC10/Doc1 as a subunit of anaphase promoting complex.
10318877 1999 Characterization of the DOC1/APC10 subunit of the yeast and the human anaphase-promoting complex.