Property Summary

NCBI Gene PubMed Count 25
PubMed Score 111.46
PubTator Score 26.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Chromosome 1p36 deletion syndrome 24 3.281 1.6

Expression

Gene RIF (1)

PMID Text
16152770 Observational study of genotype prevalence. (HuGE Navigator)

AA Sequence

MKFFLLLFTIGFCWAQYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIHNPF      1 - 70
RPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMSGNAVSAGTSSTCGSYFNPGSRD     71 - 140
FPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLVGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFR    141 - 210
LDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTV    211 - 280
IRKWNGEKMSYLKNWGEGWGFMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGF    281 - 350
TRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP    351 - 420
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKA    421 - 490
HFSISNSAEDPFIAIHAESKL                                                     491 - 511
//

Text Mined References (26)

PMID Year Title
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16152770 2005 On the genetic polymorphism of the serum alpha-amylase in the population of the south western Bulgaria (second communication).
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15286789 2004 Detection of large-scale variation in the human genome.
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11408008 2001 alpha-Amylase expressed in human liver is encoded by the AMY-2B gene identified in tumorous tissues.
11376382 2001 A comparative immunohistochemical study on amylase localization in the rat and human exocrine pancreas.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8268204 1993 Identification of the characteristic amino-acid sequence for human alpha-amylase encoded by the AMY2B gene.
6608795 1984 Regional assignment of human amylase (AMY) to p22----p21 of chromosome 1.
3260028 1988 Human pancreatic amylase is encoded by two different genes.
2788608 1989 The human alpha-amylase multigene family consists of haplotypes with variable numbers of genes.
2701942 1989 A novel type of human alpha-amylase produced in lung carcinoid tumor.
2483397 1989 The human amylase-encoding genes amy2 and amy3 are identical to AMY2A and AMY2B.
2458567 1988 Expression of the human amylase genes: recent origin of a salivary amylase promoter from an actin pseudogene.
2452973 1988 Concerted evolution of human amylase genes.
2401405 1990 Cloning and characterization of a third type of human alpha-amylase gene, AMY2B.
2081604 1990 Evolution of the human alpha-amylase multigene family through unequal, homologous, and inter- and intrachromosomal crossovers.
1692298 1990 Mapping the human amylase gene cluster on the proximal short arm of chromosome 1 using a highly informative (CA)n repeat.
1429515 1992 Detection of human urinary alpha-amylase encoded by the AMY2B gene using a fluorogenic substrate, FG5P.
890964 1977 The action of human pancreatic and salivary isoamylases on starch and glycogen.
309725 1978 Human pancreatic alpha-amylase: phenotypic codominance and new electrophoretic variants.