Property Summary

NCBI Gene PubMed Count 25
PubMed Score 13.07
PubTator Score 12.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
glioblastoma 1.300 7.5e-03
medulloblastoma 1.300 1.3e-03
medulloblastoma, large-cell 1.200 1.4e-04
primitive neuroectodermal tumor 1.100 3.1e-04
pancreatic ductal adenocarcinoma liver m... -1.274 3.0e-02
intraductal papillary-mucinous carcinoma... -1.700 8.0e-05
lung adenocarcinoma -1.300 1.6e-17
breast carcinoma -1.200 3.7e-37
Breast cancer -2.000 1.0e-12
invasive ductal carcinoma -1.500 1.7e-03
ovarian cancer -1.600 2.3e-04
pituitary cancer -1.900 2.5e-04

Gene RIF (11)

PMID Text
26806348 AMOTL1 Promotes Breast Cancer Progression and Is Antagonized by Merlin.
25633977 Knockdown of Angiomotin (AMOT) by siRNA inhibits HIV-1 release and infectivity, but expression of AMOT-like protein 1 and AMOT-like protein 2 can rescue HIV-1 Gag release
25373897 phosphorylation-deficient S793Ala mutant of AMOTL1 showed a shorter half-life and conferred resistance to energy-stress-induced YAP inhibition.
25218344 miR-124 binds AmotL1 3'UTR and down-regulates its expression repressing vasculogenic mimicry and cell motility in cervical cancer cells.
24349473 study defined eight additional recurrently mutated genes in SMZL; these genes are CREBBP, CBFA2T3, AMOTL1, FAT4, FBXO11, PLA2G4D, TRRAP and USH2A.
24003252 Scaffold proteins angiomotin (Amot) and angiomotin-related AmotL1 and AmotL2 were recently identified as negative regulators of YAP and TAZ by preventing their nuclear translocation.
23793505 These results suggested that IFN-gamma exhibits anti-angiogenesis effects by regulating the expression of TNF-alpha-induced AmotL1 via NFkappaB in emphysema lungs.
21685940 AmotL1 and ZO-2 are two candidates that could be harnessed to control the oncogenic function of YAP.
19932912 By yeast two-hybrid screening, angiomotin-like 1 (AmotL1) was identified as a host factor that interacts with the M protein of parainfluenza virus 5 (PIV5).
19590046 Amot and AmotL1 have similar effects on endothelial migration and tight junction formation in vitro. In vivo Amot appears to control the cell polarity and AmotL1 affects the stability of cell-cell junctions.
19565639 The angiomotin-like 1 is involved in actin-cytoskeleton-based processes, in part, via its interaction with a p80-angiomotin-containing complex and the actin cytoskeleton

AA Sequence

MWRAKLRRGTCEPAVKGSPSACYSPSSPVQVLEDSTYFSPDFQLYSGRHETSALTVEATSSIREKVVEDP      1 - 70
LCNFHSPNFLRISEVEMRGSEDAAAGTVLQRLIQEQLRYGTPTENMNLLAIQHQATGSAGPAHPTNNFSS     71 - 140
TENLTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEEAKAQSQFFRGQQQQQQQ    141 - 210
QGAVGHGYYMAGGTSQKSRTEGRPTVNRANSGQAHKDEALKELKQGHVRSLSERIMQLSLERNGAKQHLP    211 - 280
GSGNGKGFKVGGGPSPAQPAGKVLDPRGPPPEYPFKTKQMMSPVSKTQEHGLFYGDQHPGMLHEMVKPYP    281 - 350
APQPVRTDVAVLRYQPPPEYGVTSRPCQLPFPSTMQQHSPMSSQTSSASGPLHSVSLPLPLPMALGAPQP    351 - 420
PPAASPSQQLGPDAFAIVERAQQMVEILTEENRVLHQELQGYYDNADKLHKFEKELQRISEAYESLVKST    421 - 490
TKRESLDKAMRNKLEGEIRRLHDFNRDLRDRLETANRQLSSREYEGHEDKAAEGHYASQNKEFLKEKEKL    491 - 560
EMELAAVRTASEDHRRHIEILDQALSNAQARVIKLEEELREKQAYVEKVEKLQQALTQLQSACEKREQME    561 - 630
RRLRTWLERELDALRTQQKHGNGQPANMPEYNAPALLELVREKEERILALEADMTKWEQKYLEESTIRHF    631 - 700
AMNAAATAAAERDTTIINHSRNGSYGESSLEAHIWQEEEEVVQANRRCQDMEYTIKNLHAKIIEKDAMIK    701 - 770
VLQQRSRKDAGKTDSSSLRPARSVPSIAAATGTHSRQTSLTSSQLAEEKKEEKTWKGSIGLLLGKEHHEH    771 - 840
ASAPLLPPPPTSALSSIASTTAASSAHAKTGSKDSSTQTDKSAELFWPSMASLPSRGRLSTTPAHSPVLK    841 - 910
HPAAKGTAEKLENSPGHGKSPDHRGRVSSLLHKPEFPDGEMMEVLI                            911 - 956
//

Text Mined References (34)

PMID Year Title
26806348 2016 AMOTL1 Promotes Breast Cancer Progression and Is Antagonized by Merlin.
25373897 2014 Energy stress regulates hippo-YAP signaling involving AMPK-mediated regulation of angiomotin-like 1 protein.
25218344 2014 MiR-124 represses vasculogenic mimicry and cell motility by targeting amotL1 in cervical cancer cells.
24349473 2013 Whole exome sequencing identifies novel recurrently mutated genes in patients with splenic marginal zone lymphoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24003252 2013 Angiomotin'g YAP into the nucleus for cell proliferation and cancer development.
23793505 2013 The role of tumor necrosis factor-? and interferon-? in regulating angiomotin-like protein 1 expression in lung microvascular endothelial cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22385262 2012 The Nedd4-like ubiquitin E3 ligases target angiomotin/p130 to ubiquitin-dependent degradation.
22362771 2012 The Amotl2 gene inhibits Wnt/?-catenin signaling and regulates embryonic development in zebrafish.
21685940 2012 Opposing roles of angiomotin-like-1 and zona occludens-2 on pro-apoptotic function of YAP.
21187284 2011 Angiomotin-like proteins associate with and negatively regulate YAP1.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19932912 2010 PIV5 M protein interaction with host protein angiomotin-like 1.
19590046 2009 Angiomotin-like protein 1 controls endothelial polarity and junction stability during sprouting angiogenesis.
19565639 2009 Human angiomotin-like 1 associates with an angiomotin protein complex through its coiled-coil domain and induces the remodeling of the actin cytoskeleton.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16381901 2006 The LIFEdb database in 2006.
16019084 2005 Identification and characterization of a novel tight junction-associated family of proteins that interacts with a WW domain of MAGI-1.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12406577 2002 Angiomotin belongs to a novel protein family with conserved coiled-coil and PDZ binding domains.
11733531 2002 JEAP, a novel component of tight junctions in exocrine cells.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.