Property Summary

NCBI Gene PubMed Count 269
PubMed Score 2413.15
PubTator Score 1752.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
oligodendroglioma 1.300 3.3e-02
primitive neuroectodermal tumor 1.300 2.7e-03
sonic hedgehog group medulloblastoma 1.400 4.5e-04

Gene RIF (246)

PMID Text
27147497 The proportion of circulating proAMH as a percentage of total AMH was twofold higher in boys than men, with girls also exhibiting lesser cleavage of their AMH than women.
26961579 Data from Poland suggest that serum AMH levels are up-regulated in women with polycystic ovary syndrome (PCOS) and type 1 diabetes (T1DM) as compared to women with T1DM alone; no differences are observed between either PCOS plus T1DM or PCOS alone.
26948535 Data from Poland suggest serum AMH levels are up-regulated in women with polycystic ovary syndrome (PCOS) and type 1 diabetes (T1DM) as compared to women with T1DM alone; no differences are observed between either PCOS plus T1DM or PCOS alone. [EDITORIAL]
26848671 Neither AMH nor AMHR2 polymorphisms were related to age, BMI, hormone levels or ovarian parameters in the follicular phase in women of late reproductive stage.
26828745 Data suggest that the ratio of anti-Mullerian hormone precursor (proAMH) to anti-Mullerian hormone (AMHN,C) in the circulation is not altered after it is released from the gonads.
26732661 The AMH and AMHRII gene polymorphisms were not found a significant difference in non-IR-PCOS and normal groups. To IR-PCOS women, genotypes of AMH were closely related to the serum levels of LH (P = 0.000), testosterone (P = 0.000) and HOMA-IR (P = 0.038), while in the non-IR-PCOS and normal groups, no relationship was found
26631403 These findings contribute in clarifying the relationship between hormones regulating the early phase of steroidogenesis confirming that AMH is playing a suppressive role on CYP19A1 expression stimulated by gonadotropin in hGCs. Furthermore, a similar inhibitory effect for AMH was observed on P450scc gene expression when activated by gonadotropin treatment.
26604150 SNPs at the AMH gene locus that strongly predict serum AMH levels in males.
26596960 unilateral ovarian endometriosis had a moderately negative and nonsignificant effect on AMH-based ovarian reserve evaluated prior to surgery, irrespective of age
26579638 Healthy eumenorrheic late adolescent females with sporadic anovulation display higher AMH blood concentration.
26549157 From birth-18 years AMH increases. It declines thereafter, indicating changes of ovarian maintenance. Positive relationship between androgenic profiles/AMH during adolescence/reproductive years implies synchronism between androgens and ovarian reserve.
26515380 Refusing fertility treatment solely on the basis of ultralow AMH levels is not advisable, but patients should be counseled appropriately about the prognostic factors for cancellation and outcomes.
26477497 Report a follicular phase rise in serum AMH levels, particularly in women over the age of 30 years.
26464718 There is no association between single nucleotide polymorphisms in the AMH/AMHR2 signaling pathway and early ovarian hyperstimulation syndrome in Han Chinese women
26452703 The Sertoli cell hormones inhibin-B and anti Mullerian hormone have different patterns of secretion in prepubertal cryptorchid boys.
26452591 Plasma AMH levels were lower in chronic kidney disease stages 1-4 by 30% and by 70% in CKD stage 5 compared with controls.
26384163 AMH concentrations vary across ovulatory menstrual cycles, showing a significant periovulatory decrease. The number of small antral follicles can be estimated from preovulatory AMH levels with relevance for patient management.
26315051 Dynamic AMH levels may provide a novel intracycle approach to predict response and treatment outcomes after IVF.
26252060 Data indicate that the pattern of serum anti-Mullerian hormone (AMH) expression can delineate testicular damage.
26238387 High antimullerian hormone levels were associated with polycystic ovary syndrome.
26230428 Serum AMH is a sensitive marker of age-related decline in ovarian reserve status. A serum AMH result >36 pmol L(-1), or above the 75th percentile for age, is highly suggestive of a diagnosis of polycystic ovary syndrome.
26158904 Due to a lower threshold of detection, picoAMH may be able to predict successful ovarian stimulation among women with DOR using a threshold of 500 pg/mL, with good sensitivity and specificity.
26156856 These data support incorporation of AMH as diagnostic criterion for PCOS regardless of age, and imply that testosterone should not be relied upon in the diagnosis of polycystic ovary syndromein older women.
26144573 Low AMH levels are associated with a statistically significantly lower likelihood of blastocysts for cryopreservation as compared with higher AMH levels.
26074093 A lack of decline in the AMH level in early pregnancy can be used to identify women with a high probability for preterm birth.
26024525 Short-Term PTEN Inhibition Improves In Vitro Activation of Primordial Follicles, Preserves Follicular Viability, and Restores AMH Levels in Cryopreserved Ovarian Tissue From Cancer Patients.
26003269 Antimullerian hormone levels can accurately identify the likelihood of live birth.
25972076 study demonstrated for the first time that human placenta and fetal membranes express and co-localize Anti-Mullerian hormone(AMH) and Anti-Mullerian hormone receptor II and that AMH is a gender specific hormone
25826396 A relationship between the level of anti-Mullerian hormone and depressive symptoms was not confirmed in the group of healthy late-reproductive-age women.
25824010 Anti-Mullerian hormone declined with women's increasing age in both plasma and peritoneal fluid in women with and without endometriosis.
25796318 Antral follicle count-derived ovarian biologic age reflects a more precise background risk for fetal aneuploidy that is not observed for AMH-derived age.
25790842 AMH rs2002555 polymorphisms is associated with the number of embryos produced.
25772768 Testosterone treatment resulted in a strong suppression of AMH secretion over a relative short period of 16 weeks in female-to-male transsexuals.
25750103 three missense variants of the AMH gene were found in three different patients of a cohort of premature ovarian insufficiency patients
25651719 Basal serum AMH level represents a promising test in prediction of ovarian reserve, good quality of retrieved eggs and fertilized embryos, and pregnancy rate in infertile women undergoing ICSI.
25581422 inhibin B and anti-Mullerian hormone serum concentrations did not provide an additional diagnostic tool for male infertility
25558667 This study presents a comparison of the serum levels of Anti-Mullerian Hormone in major phenotypes of polycystic ovarian syndrome (A, B, C, D).
25542251 There was evidence that in specific subgroups of women undergoing IVF/ICSI, AMH and AMHRII SNPs may be related to patients' characteristics and controlled ovarian stimulation and pregnancy outcome
25500128 Results show that AMH is highly expressed and secreted from cumulus granulosa cells of advanced age patients suggesting that it may be involved in follicular aging process.
25488203 AMH levels were inversely correlated with TSH levels in infertile women of reproductive age.
25467043 Subfertile women with polycystic ovary syndrome secrete significantly more antimullerian hormone per antral follicle than controls.
25405500 Our findings suggest that women with inherited bone marrow failure syndromes have lower levels of AMH than unaffected women.
25337276 Suggest that low serum AMH level may indicate early ovarian aging in accelerated oocyte loss only, but may not fully represent "early ovarian aging" based on the favorable outcomes of pregnancy.
25329139 Elevated serum AMH levels in polycystic ovary syndrome women seem to be related only to follicular excess and not follicular arrest
25322464 This study concluded that AMH could mediate the actions of BMPs in regulating follicular development and contributing to the determination of ovulation numbers.
25241372 study reports a modulatory role for AMH as an ovarian/follicular autocrine/paracrine factor controlling stem cell factor expression via the cAMP/PKA pathway in granulosa cells
25222840 Our study shows that AMH levels do not change during follicular development in controls as well as in PCOS patients with AMH levels < 5 ng/ml, irrespective of antiestrogen or FSH therapy.
25152514 Data suggest that up-regulation of AMH in plasma at baseline menses in women undergoing ovulation induction/intracytoplasmic sperm injection is strong predictor of live birth; birth rate is highest when AMH level is >2 ng/ml.
25086280 In this review, anti-Mullerian hormone was found to be a useful marker of oocyte yield in ovarian reserve.
25040369 Anti-Mullerian hormone levels were increased in women with polycystic ovary syndrome regardless of adiposity.
25036408 AMH was not found to be a reliable predictor for the presence of polycystic ovary syndrome (PCOS), and serum AMH did not differ between obese and non-obese adolescent patients with PCOS.
25026127 Two heterozygous mutations of the AMH gene is associated with persistent Mullerian duct syndrome.
25012254 A rare SNP of AMH was associated with decreased risk of polycystic ovary syndrome.
25009087 Serum AMH is lower in women with bilateral ovarian cysts and this does not appear to be related to the histology or dimension of the lesions.
24951363 Report picoAMH assay, allowing measurement of very low AMH concentrations in human serum, should refine postchemotherapy ovarian follow-up in young women.
24912417 These findings suggest that patients with primary ovarian insufficiency in China share AMH and AMHR2 genetic variants with those who go through menopause at a normal age.
24898132 elevated in polycystic ovary syndrome, particularly in PCOS with insulin resistance
24886254 The role of AMH in regulating cell viability and proliferation of endometriosis cells.
24746743 Report elevated serum AMH levels in polycystic ovarian syndrome.
24707500 the delayed time to pregnancy observed in women treated with LEEP is likely not due to a LEEP-associated decrease in ovarian reserve as measured by AMH; thus, other mechanism are responsible for the delayed time to pregnancy associated with LEEP.
24666685 In this review, serum AMH levels in pretreatment breast cancer patients predict long-term ovarian function.
24661732 Antral follicle count, AMH, and free testosterone discriminated with high accuracy between women with PCOS and controls.
24620523 Women with uterine leiomyomatosis had lower serum levels of anti-Mullerian hormone, compared to women without leiomyomatosis
24613539 Increased expression of antimullerian hormone in patients with endometriosis suggests a possible involvement of AMH in endometriosis.
24593938 The vast majority of women with AMH >10 ng/mL have polycystic ovarian syndrome (PCOS). Increased AMH levels correlate with PCOS severity and are associated with greater ovarian stimulation and higher pregnancy rates following assisted reproduction.
24576226 Data suggest that increased serum AMH level can serve as biomarker to predict risk of ovarian hyperstimulation syndrome in infertile women undergoing ovulation induction.
24424371 The leading enzyme-linked assay for AMH provides a composite value of two biologically distinct forms of AMH. Future research into the physiology and clinical utility of AMH should consider the two forms separately.
24345579 serum AMH is lower in girls with newly diagnosed cancer than in age-matched controls; AMH levels correlate with impairment of general health status
24312319 Anti-Mullerian hormone recruits BMPR-IA in immature granulosa cells
24292596 Serum AMH levels are strongly associated with the number of retrieved oocytes and the availability of supernumerary embryos suitable for cryopreservation.
24290000 There was a decline in serum antimullerian levels after laproscopic ovarian cystectomy in endometrioma and ovarian cysts.
24219729 Serum level of anti-Mullerian hormone is not predictive of spontaneous onset of pregnancy
24210790 Patients with severe endometriosis had significantly lower serum AMH than controls, demonstrating of the damage of endometriosis on ovarian reserve.
24182412 Latina and Chinese women have lower AMH levels compared with white women and African American women experience less of a reduction in AMH with advancing age.
24172648 Serum AMH was significantly lower 2 days and 3 months following hysterectomy compared with the pre-operative level. Hysterectomy may have a more lasting adverse effect on ovarian reserve than myomectomy
24146295 Within primary ovarian insufficiency population, the AMH Ile(49)Ser and the AMHR2 -482A>G polymorphisms were not associated with age at the time of POI and LH, FSH as well as estradiol levels.
24098470 Up-regulation of SOX9 in sertoli cells from testiculopathic patients accounts for increasing anti-mullerian hormone expression via impaired androgen receptor signaling
24083876 The AMH value in female childhood cancer survivors identified patients at risk for delayed puberty.
24069435 the serum AMH level measured in a previous cycle can be used to predict the risk of cycle cancelation and the chances of good ovarian response, when analyzed together with patient's age or serum FSH.
24045871 Boys and young adults have the same form of AMH, with a significant proportion being the inactive precursor. This raises the possibility that the endocrine functions of AMH are partly controlled by its cleavage in the target organ.
23968732 Pretreatment AMH is a useful predictor of long term post chemotherapy loss of ovarian function in women with early breast cancer.
23928669 INSL3 and AMH levels are significantly correlated with each other in women with PCOS, and they are significantly increased, particularly in the presence of amenorrhea and oligomenorrhea.
23876536 Diet reduces serum AMH in association with decreased androgen levels in obese women with polycystic ovary syndrome.
23850305 The combined effect of FSHB GG+FSHR AA may potentiate the FSH pathway, which increases serum levels of FSH and reduces antimullerian hormone in health girls.
23847299 AMH concentration is a strong, novel correlate to the diameter of the abdominal aorta, with this correlation being independent of known physical and metabolic determinants of the aorta
23810163 Expression of mullerian inhibiting substance was found in papillary thyroid cancer tissue but not in normal thyroid tissue.
23785020 AMH levels are reduced in healthy male volunteers treated with growth hormone and a growth hormone antagonist.
23762215 Anti-mullerian hormone is not associated with cardiometabolic risk factors in adolescent females.
23690308 Data suggest that in classic galactosemia most girls exhibit low circulating levels of AMH (a biological marker of ovarian reserve) by age 3 months; longitudinal data suggest that once AMH falls to undetectable levels it rarely rises again.
23664458 There are significant differences in serum anti-Mullerian hormone levels in patients with diminished ovarian reserve before and after supplementation with dehydroepiandrosterone (DHEA).
23640374 our data also showed that patients over age 40 with extreme low levels of AMH still had a chance of pregnancy.
23608780 Serum AMH may be used as a marker to identify candidates for IVM treatment in both normo-ovulatory (NO) women and in women with Polycystic Ovary Syndrome .
23554429 AMH levels in women with rheumatoid arthritis are comparable to those of healthy controls.
23553200 AMH values were significantly higher in polycystic ovary syndrome cases when compared with controls.
23544102 A statistically significant interaction between rs10407022 in AMH and rs11170547 in AMHR2 (p = 0.019) associated with age at natural menopause.
23541317 [review] Serum antimullerian hormone provides an indirect measure of the ovarian reserve, a key goal in reproductive medicine.
23533229 Data suggest that several reproductive and lifestyle factors are associated with age-specific serum AMH levels; lower serum AMH levels associated with oral contraceptive use and smoking appear to be reversible.
23533225 Data from infertile women suggest that the combination of circulating follicle stimulating hormone/anti-mullerian hormone (FSH/AMH) high/high results in surprisingly favorable outcomes from fertilization in vitro (high pregnancy rate).
23509105 Is circulating AMH a biological marker for age at menopause? Data suggest that circulating AMH becomes undetectable (<0.2 ng/mL) approximately 5 years before occurrence of menopause.
23461296 AMH is not predictive for clinical pregnancy rates in women with polycystic ovary syndrome undergoing in vitro fertilization treatment.
23452339 [review] One of the best available methods to determine ovarian reserve, due to its biochemical and pathological characteristics, is anti-Mullerian hormone.
23433830 Antimullerian hormone concentration varies during the menstrual cycle and altered clinical classification of ovarian response.
23433069 Increased expression of anti-Mullerian hormone is observed in granulosa-luteal cells of patients receiving luteinizing hormone treatment.
23419927 Measurement of circulating AMH and inhibin B levels suggests that the rate of ovarian primordial follicle recruitment increases in the prepubertal years then declines again following the onset of puberty as follicular activity pattern changes.
23408576 AMH is strongly associated with live-birth rates after IVF-intracytoplasmic sperm injection.
23394782 Serum antimullerian hormone concentration strongly correlates with oocyte yield in ovarian stimulation patients.
23390860 Women with polycystic ovary syndrome are considered to have significantly lower levels of AMH as compared with controls. [review]
23371438 SNPs rs10407022 and rs8112524 in the AMH gene did not affect susceptibility to polycystic ovarian syndrome (PCOS). However, the TA haplotype might enhance susceptibility to PCOS while GA might be protective.
23368705 Results reveal the importance of AMH as a predictor of ovarian reserve in endometrioma and therefore of folliculogenesis; in fact it shows only a slight decrease in the early postoperative phase.
23295284 A likely molecular etiology was found in eight patients with persistent Mullerian duct syndrome. Four mutations in AMH and two in AMHR2 were identified. Three of them are novel mutations, c.556-2A>G, and p.Arg502Leu in AMH; and p.Gly323Ser in AMHR2.
23051961 Serum AMH values were negligible for postmenopausal women older than 65 years.
23044647 AMH is a sensitive marker for ovarian damage due to previous cyclophosphamide exposure in women with systemic lupus erythematosus.
23002694 from the primary follicular stage to the antral stage, serum levels of AMH may represent both the quantity and the quality of ovarian follicles; thus, the AMH levels may be useful as a new potential marker of the ovarian reserve
22984527 Anti-Mullerian hormone serum values may predict a decrease in ovarian reserve during assisted reproduction therapy
22921911 The AMH rate of change was independently associated with time to menopause in late reproductive-age women.
22910001 Data show the anti-Mullerian hormone receptor diabody refolding protocol.
22901847 Circulating AMH declined significantly after the first 3 months of long-acting GnRH-a treatment in girls with central precocious puberty and early puberty.
22821432 Data suggest that endometriosis and endometrioma do not result in lower anti-Mullerian hormone (AMH) serum levels; AMH serum levels are decreased in women with previous endometrioma surgery independently of current endometrioma.
22814098 There is a significant relationship between serum anti-Mullerian hormone levels and ongoing pregnancy rate after in vitro fertilization.
22771030 Baseline serum AMH </= 4 ng/mL was associated with ovulatory function in polycystic ovary syndrome.
22693172 Anti-Mullerian hormone may have a role in polycystic ovary syndrome and could be used in diagnosis
22674205 blood AMH may be a useful indicator for assessing ovarian reserve
22673409 investigation of cut-off serum levels of anti-Mullerian hormone for diagnosis of polycystic ovary syndrome in women in South Korea
22563903 investigation of usefulness of anti-Mullerian hormone level in blood as diagnostic marker for infertility in women who previously underwent chemoradiotherapy for childhood cancer
22552379 Body mass index does not have an effect on serum AMH levels in women of reproductive age.
22545082 AMH and follicle stimulating hormone are predictive of pregnancy potential in high responders, but likely reflect different responsibilities in recruitment and maturation of growing follicle cohorts.
22442264 AMH elimination reaches approximately 84% after 3 d, approximately 91% after 4 days, approximately 95% after 5 days, and can be considered complete after 8 days.
22429116 no evidence that follicle-stimulating hormone receptor p.Asn680Ser genotypes associated with high anti-mullerian hormone levels
22420235 Anti-Mullerian hormone: a unique biochemical marker of gonadal development and fertility in humans.
22405597 The gonadotropin-mediated early pubertal increase in inhibin B is tightly coupled to decrease in AMH levels and may reflect androgen-mediated differentiation of Sertoli cells.
22401810 Report low AMH levels in infertility patients with a reduced ovarian response to gonadotropin stimulation.
22355044 The average expression of AMH was significantly higher in egg donors, and the average expression of LHCGR was significantly higher in DOR patients.
22244782 AMH measurements were found to be applicable in evaluation of the reproductive function of young women.
22188863 AMH gene mutations were found in two Egyptian families with persistent mullerian duct syndrome with very low and almost undetectable AMH levels.
22154766 Metformin had no impact on maternal or fetal androgen levels or the level of AMH in mothers with polycystic ovary syndrome and their newborns.
22049172 AMH levels in men after puberty are under a strong genetic influence. Twin modeling suggests that AMH and BMI are influenced by different sets of genes.
22038452 Data suggest that serum AMH concentration-a Sertoli cell marker evaluating gonadal function-is lower in boys with unilateral cryptorchidism operated upon between the 1st and 4th year of life.
21882017 Measurement of basal serum AMH can be used to determine the women with high risk for ovarian hyperstimulation syndrome .
21789206 This model shows that 34% of the variation in AMH is due to age alone.
21784736 AMH level is suggestive of the presence of polycystic ovarian morphology during adolescence
21724534 A review of the clinical usefulness of anti-Mullerian hormone evaluation in the fields of gynecological endocrinology, menopause, gynecological oncology and assisted reproduction.
21719005 AMH is not an accurate marker of ovarian response after low-dose FSH ovulation induction in patients with polycystic ovary syndrome.
21704216 AMH levels are inversely associated with age and differed significantly between oral contraceptive pill users and nonusers.
21576079 For all women, AMH was found to decrease by 10% per year. The added effect of having a FMR1 premutation decreased AMH levels by 54%.
21529798 Overweight and obese women with diminished ovarian reserve (DOR) as defined by high day 3 serum FSH levels have lower serum AMH levels and number of oocytes retrieved compared with nonobese women with DOR.
21514928 Measuring AMH and ovarian stromal three-dimensional power Doppler blood flow for women with anovulatory polycystic ovary syndrome undergoing laparascopic ovarian drilling may provide a useful tool in evaluating the outcome of LOD.
21514585 Follicle stimulating hormone may inhibit the excessive secretion of AMH by suppressing the activity of AMH promoter in polycystic ovary syndrome granulosa cells.
21497340 Random anti-Mullerian hormone is a predictor of ovarian response in women with elevated baseline early follicular follicle-stimulating hormone levels.
21486417 The results suggest that the decrease in anti-Mullerian hormone (AMH) plasma levels is related to the origin of nonobstructive azoospermia (NOA), with low values in genetic NOA and values similar to obstructive azoospermia in cytotoxic NOA.
21481373 The MTHFR 677TT genotype is associated with higher serum anti-Mullerian hormone concentrations and has a negative effect on number of oocytes retrieved.
21457958 Age-related normograms in for serum AMH levels non-polycystic ovary syndrome infertile women for the 3rd to 97th percentiles were produced.
21451424 Serum AMH concentrations can reasonably forecast the age at menopause for individual women
21341396 Serum AMH alone or in combination with serum FSH may be a useful indicator of perimenopause.
21315336 Found a significant decline in serum anti-Mullerian hormone levels with consequent depletion of follicles in tissue specimens after surgery for women with ovarian endometrioma.
21315333 Report that serum AMH levels measured by ELISA two kits both could be used as controlled ovarian hyperstimulation outcome predictors with similar reference values.
21300348 Compared with fresh and slow-frozen ovaries, vitrified ovaries contained statistically significantly fewer primordial follicles and produced statistically significantly less AMH in vitro.
21285453 Inhibin B constitutes a reliable marker of Sertoli cell function as well as spermatogenesis, while the clinical significance of anti-Mullerian hormone in men with varicocele remains to be elucidated.
21227943 Circadian co-variation in the levels of AMH and LH during menstruation may indicate joint regulatory mechanisms; data indicates slight decrease in serum AMH levels during the early morning hours.
21227938 GH treatment has no effect on AMH levels in short girls born small for gestational age
21177311 Data suggest that AMH inhibits sensitivity of ovarian follicle to FSH.
21168856 Inhibin B and antimullerian hormone have a role in gonadal function after treatment for medulloblastoma or posterior fossa ependymoma during childhood
21114374 The role of the hormone in male and female development, its participation in oocyte maturation,changes under various pathological situations in both sexes (Review)
20864412 Observational study of gene-disease association. (HuGE Navigator)
20861221 AMH thus exemplifies a new mechanism for receptor engagement in which interaction with the type II receptor promotes pro-region dissociation to generate mature ligand.
20843948 Detectable AMH serum levels at all ages, with the highest measured levels during infancy in healthy males.
20809108 Serum AMH levels are elevated in adolescent and young adult Chinese patients of PCOS.
20801125 The performance of the AMH Gen II assay is ideal for investigation into the physiologic roles of AMH in men and women.
20797903 Age-specific normative values for circulating AMH concentration were established. AMH concentrations seem to be independent of the reproductive history of the patient.
20797901 This study shows that infertile patients with minimal/mild endometriosis have a similar concentration of AMH in the follicular fluid after natural IVF as compared with control subjects.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20719830 AMH seems to be a promising marker of ovarian function in healthy girls and Turner Syndrome patients
20309569 Age was negatively correlated with serum anti-Mullerian hormone levels while smoking did not have significant effects on anti-Mullerian hormone levels.
20236105 data demonstrate that polymorphisms in major folliculogenesis genes, GDF9, BMP15, AMH, and AMHR2, are not associated with polycystic ovary syndrome susceptibility.
20236105 Observational study of gene-disease association. (HuGE Navigator)
20207725 AMH appears to have a major inhibitory role during folliculogenesis, which may contribute to anovulation in polycystic ovary syndrome [review]
20155783 Maternal serum AMH level, as a marker of ovarian age, is not superior to chronological age in predicting Down syndrome pregnancies.
20150576 In oligomenorrheic adolescents, elevated serum AMH levels suggest increased antral follicle number
20064870 Concentrations of anti-Mullerian hormone in fluid from small human antral follicles show a negative correlation with CYP19 mRNA expression in the corresponding granulosa cells.
20060112 Serum AMH is a reliable predictor of polycystic ovaries morphology or for the presence of PCOS.
19940443 Data speculate that the absence of a second X chromosome leads to over-expression of MIS that may be co-responsible for failure of ovarian differentiation in TS. MIS may be a potential negative regulator of ovarian development in humans.
19800062 First-trimester antimullerian hormone is associated negatively with maternal adiposity and circulating levels decline during the second and third trimester.
19755162 Development of an efficiently cleaved, bioactive, highly pure FLAG-tagged recombinant human Mullerian Inhibiting Substance
19730683 Observational study of gene-disease association. (HuGE Navigator)
19539911 Bone morphogenetic protein-6 stimulates gene expression of anti-Mullerian hormone in human granulosa cells.
19539910 Genetic variants of AMH and AMHRII genes seem to be associated with infertility.
19539910 Observational study of gene-disease association. (HuGE Navigator)
19424576 Non-epithelial malignant ovarian tumors showed stronger expression of Mullerian inhibiting substance than that of epithelial tumors.
19409547 Results of a pilot study show that women's MIS is a biomarker of ovarian function that can be measured with good precision using a reproducible assay kit. Serum levels are relatively stable, at least over a 1-year period.
19361798 Granulosa cells from polycystic ovaries produce elevated levels of AMH, possibly because of impaired access of follicle stimulating hormone to follicles, and may have harmful consequences on oocyte quality and final maturation through unknown mechanisms.
19359032 Retrospective identification of 32 granulosa cell tumor patients who have serum MIS/AMH measurements, which correlate with tumor mass.
19345350 Measurement of serum AMH level after ovarian surgery may show a reduced level following laparoscopic cystectomy; however, it could be restored thereafter up to 3 months postoperative in reproductive women.
19342396 Anti-Mullerian hormone may have a role in polycystic ovary syndrome
19217095 In 76 IVF cycles investigated, AMH was clearly superior in predicting IVF outcomes in comparison with FSH.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19056816 MIS is up-regulated by calcitriol via a functional vitamin D receptor that binds the vitamin D response element.
18930217 There is an independent effect of race and ethnicity on the age-related decline in MIS over time.
18930199 Anti-Mullerian hormone (AMH) levels in women undergoing chemotherapy and hematopoietic stem cell transplantation facilitated earlier identification of impaired ovarian reserve compared with FSH and the resumption of menses.
18854109 The transition from resting to growing follicles leading to the development of secondary follicles showed the normal expression patterns of GDF-9 and AMH.
18697861 AMHR genes are overexpressed by granulosa cells from stimulated follicles of women with polycystic ovary syndrome undergoing controlled ovarian hyperstimulation.
18593767 AMH, an endocrine marker that reflects the transition of resting primordial follicles to growing follicles, declined to a time point 5 yr prior to the final mentrual period.
18555223 A statistical association between follitropin and AMH in assessing ovarian reserve.
18381582 The insignificant variation of the AMH concentration with age, even in prepubertal girls, suggests that AMH expression is unrelated to menstrual cycle FSH cyclicity.
18328480 Adult human endometrium possesses a functional MIS signal transduction system which negatively regulates cellular viability.
18321493 Review/Meta-Analysis: The role of antimullerian hormone in prediction of outcome after IVF: comparison with the antral follicle count.
18310677 preliminary data suggest that AMH levels indicate early ovarian decline among women with longer FMR1 repeat alleles; moreover, AMH appears to be a better marker than FSH in identifying this early decline.
18291376 The AMH and inhibin B levels on the day of oocyte retrieval are correlated to assisted reproductive outcome.
18249391 Fluctuations observed are smaller than intercycle variability and thus are not clinically relevant as far as AMH measurements for clinical purposes are concerned.
18249372 Suggest that there is no significant difference in follicular microenvironment in terms of AMH secretion between GnRH agonist/antagonist protocols and that follicular fluid AMH is a marker that reflects ovarian reserve and response to ovarian stimulation.
18230658 Observational study of gene-disease association. (HuGE Navigator)
18191888 Anti-Mullerian hormone levels in premature ovarian failure patients could identify women with persistent follicles.
17926161 Serum anti-Mullerian hormone (AMH) levels differentiate control from subfertile men but not men with different causes of subfertility
17636279 Observational study of gene-disease association. (HuGE Navigator)
17628551 Granulosa cell production of AMH is augmented by pharmacologically induced increase in the intrafollicular androgen levels.
17624337 Infertile patients with endometriosis have a decreased serum anti-Mullerian hormone.
17603052 Levels of AMH show a statistically significant change during the menstrual cycle and may influence the circulating gonadotropin and steroid hormone levels.
17559842 MIS is the earliest marker to change with agem has it has least intercycle variabilityane has the least intracycle variability; and 4) it may be informative if randomly obtained during the menstrual cycle. {REVIEW]
17543956 Oocytes are more likely to be fertilized when follicles are able to make high concentrations of AMH in the follicular fluid. AMH could be a prediction marker for fertilization.
17488788 AMH concentrations are increased in peripubertal daughters of polycystic ovary syndrome women
17485437 anti-Mullerian hormone expression is stable during the menstrual cycle
17462637 Serum AMH and inhibin B are significantly lower in the men with nonobstructive azoospermia compared to the controls.
17425826 Mullerian inhibiting substance has a role in response to ovarian stimulation
17337470 Polymorphisms in the AMH and AMHR2 genes are associated with follicular phase E(2) levels, suggesting a role for AMH in the regulation of FSH sensitivity in the human ovary.
17335955 serum anti-mullerian hormone (AMH) levels in Polysystic Ovary Syndrome patients were significantly higher than in healthy women
17088539 MIS in combination with selective targeted therapies might achieve greater activity against ovarian cancer than the use of each individual agent alone
16923748 Hence, AMH exhibits a relatively stable expression during the menstrual cycle, making it an attractive determinant of ovarian activity.
16816803 Its main physiological role is the induction of regression of Mullerian ducts in male fetuses but it also plays a role in Leydig cell steroidogenesis and in follicular development
16740653 Mullerian inhibiting substance regulates androgen-induced gene expression and growth in prostate cancer cells through a nuclear factor-kappaB-dependent Smad-independent mechanism.
16566934 MIS could potentially serve as a useful marker for identifying patients at risk for OHSS.
16368745 AMH could thus be used as a diagnostic criterion and incorporated as such in the Rotterdam definition of polycystic ovary syndrome.
16213847 Increased MIS production in adolescent girls may represent an early manifestation of polycystic ovary syndrome
16159935 Aggressive granulosa cell tumors(GCTs) retain high GATA-4 expression, whereas larger tumors lose proliferation-suppressing anti-Mullerian hormone expression. High GATA-4 expression in GCTs may serve as marker of poor prognosis.
16030171 a relative deficiency of AMH in primordial and transitional follicles in ovaries may contribute to disordered early follicle development in polycystic ovary syndrome
15897891 AMH is also a gonadal tumor suppressor which mediates its effects through a specific type II receptor and the bone morphogenetic protein (BMP)-specific Smad proteins.
15550498 AMH promoter sequence variations or the previously proposed SF3a2-AMH fusion co-transcripts cannot be responsible for aberrant AMH expression leading to Mullerian duct degradation.
15536161 Recombinant follitropin and chorionic gonadotropin stimulation of the testis dramatically suppresses the secretion of AMH in hypogonadism.
15217995 Serum AMH concentrations decrease over time both in women presenting with WHO 2 anovulatory infertility and in normal women. Decrease in WHO 2 patients is less pronounced despite distinctly elevated concentrations. May suggest retarded ovarian ageing.
15070957 In XXY adolescents, AMH and INHB were undetectable
14742691 Anti-Mullerian hormone expression pattern in the human ovary follicle.
14715867 serum anti-Mullerian hormone (AMH) concentrations are elevated in normogonadotropic anovulatory infertile women (WHO 2) women, especially in those patients exhibiting polycystic ovary syndrome
14671316 Induction of p130 and p107 play an important role in the inhibition of growth of C33A cells by MIS.
14671196 Increase of anti-Mullerian hormone(AMH) serum level in polycystic ovary syndrome is consequence of androgen-induced excess in small antral follicle number, and each follicle produces normal amount of AMH.
12571168 results indicate that serum AMH levels are strongly correlated with ovarian follicular status during the early follicular phase
12477536 Observational study of gene-disease association. (HuGE Navigator)
12462075 Review. The role of AMH in gonadal development and its mutation in the persistent Mullerian duct syndrome is discussed.
12456604 poor response in IVF, indicative of a diminished ovarian reserve, is associated with reduced baseline serum AMH concentrations
11773638 Administration of MIS to male mice induced IEX-1S mRNA in the prostate in vivo, suggesting that MIS may function as an endogenous hormonal regulator of NF-kappaB signaling and growth in the prostate gland.

AA Sequence

MRDLPLTSLALVLSALGALLGTEALRAEEPAVGTSGLIFREDLDWPPGSPQEPLCLVALGGDSNGSSSPL      1 - 70
RVVGALSAYEQAFLGAVQRARWGPRDLATFGVCNTGDRQAALPSLRRLGAWLRDPGGQRLVVLHLEEVTW     71 - 140
EPTPSLRFQEPPPGGAGPPELALLVLYPGPGPEVTVTRAGLPGAQSLCPSRDTRYLVLAVDRPAGAWRGS    141 - 210
GLALTLQPRGEDSRLSTARLQALLFGDDHRCFTRMTPALLLLPRSEPAPLPAHGQLDTVPFPPPRPSAEL    211 - 280
EESPPSADPFLETLTRLVRALRVPPARASAPRLALDPDALAGFPQGLVNLSDPAALERLLDGEEPLLLLL    281 - 350
RPTAATTGDPAPLHDPTSAPWATALARRVAAELQAAAAELRSLPGLPPATAPLLARLLALCPGGPGGLGD    351 - 420
PLRALLLLKALQGLRVEWRGRDPRGPGRAQRSAGATAADGPCALRELSVDLRAERSVLIPETYQANNCQG    421 - 490
VCGWPQSDRNPRYGNHVVLLLKMQVRGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR    491 - 560
//

Text Mined References (271)

PMID Year Title
27396341 2016 Anti-Müllerian Hormone Signaling Regulates Epithelial Plasticity and Chemoresistance in Lung Cancer.
27147497 2016 Relative levels of the proprotein and cleavage-activated form of circulating human anti-Müllerian hormone are sexually dimorphic and variable during the life cycle.
26961579 2016 Serum anti-Müllerian hormone concentration in women with polycystic ovary syndrome and type 1 diabetes mellitus.
26948535 2016 Presence of type 1 diabetes in women with polycystic ovary syndrome: Does it have any impact on anti-Müllerian hormone concentrations?
26848671 2016 The Relationship between AMH and AMHR2 Polymorphisms and the Follicular Phase in Late Reproductive Stage Women.
26828745 2016 The Anti-Müllerian Hormone Precursor (proAMH) Is Not Converted to the Receptor-Competent Form (AMHN,C) in the Circulating Blood of Mice.
26753790 2016 Novel role for anti-Müllerian hormone in the regulation of GnRH neuron excitability and hormone secretion.
26732661 2016 Anti-Müllerian hormone gene polymorphism is associated with androgen levels in Chinese polycystic ovary syndrome patients with insulin resistance.
26631403 2016 The anti-Müllerian hormone (AMH) acts as a gatekeeper of ovarian steroidogenesis inhibiting the granulosa cell response to both FSH and LH.
26604150 2016 Genome-wide association study identifies common and low-frequency variants at the AMH gene locus that strongly predict serum AMH levels in males.
26596960 2015 Age-related trends in anti-Mullerian hormone serum level in women with unilateral and bilateral ovarian endometriomas prior to surgery.
26579638 2015 Anti-müllerian hormone and insulin-like 3 levels in healthy normal-weight ovulatory and anovulatory eumenorrheic late adolescent females: potential early biomarkers of ovarian dysfunction?
26549157 2016 Antimüllerian hormone: correlation with age and androgenic and metabolic factors in women from birth to postmenopause.
26515380 2016 Prognostic indicators of assisted reproduction technology outcomes of cycles with ultralow serum antimüllerian hormone: a multivariate analysis of over 5,000 autologous cycles from the Society for Assisted Reproductive Technology Clinic Outcome Reporting System database for 2012-2013.
26477497 2016 Levels of antimüllerian hormone in serum during the normal menstrual cycle.
26464718 2015 Possible involvement of single nucleotide polymorphisms in anti-Müllerian hormone signaling pathway in the pathogenesis of early OHSS in Han Chinese women.
26452703 2016 The Sertoli cell hormones inhibin-B and anti Müllerian hormone have different patterns of secretion in prepubertal cryptorchid boys.
26452591 2015 Anti-Müllerian hormone, a Sertoli cell-derived marker, is decreased in plasma of male patients in all stages of chronic kidney disease.
26384163 2015 Antimüllerian hormone levels and numbers and sizes of antral follicles in regularly menstruating women of reproductive age referenced to true ovulation day.
26315051 2015 Dynamic antimüllerian hormone levels during controlled ovarian hyperstimulation predict in vitro fertilization response and pregnancy outcomes.
26252060 2015 Anti-Müllerian Hormone Is a Marker for Chemotherapy-Induced Testicular Toxicity.
26238387 2015 Antimullerian hormone levels are inversely associated with body mass index (BMI) in women with polycystic ovary syndrome.
26230428 2015 Serum anti-Mullerian hormone assessment of ovarian reserve and polycystic ovary syndrome status over the reproductive lifespan.
26163524 2015 Anti-Müllerian hormone is a gonadal cytokine with two circulating forms and cryptic actions.
26158904 2015 Can highly sensitive antimüllerian hormone testing predict failed response to ovarian stimulation?
26156856 2015 Relative importance of AMH and androgens changes with aging among non-obese women with polycystic ovary syndrome.
26144573 2015 Antimüllerian hormone as a predictor of good-quality supernumerary blastocyst cryopreservation among women with levels <1 ng/mL versus 1-4 ng/mL.
26074093 2015 Changes in antimüllerian hormone levels in early pregnancy are associated with preterm birth.
26024525 2015 Short-Term PTEN Inhibition Improves In Vitro Activation of Primordial Follicles, Preserves Follicular Viability, and Restores AMH Levels in Cryopreserved Ovarian Tissue From Cancer Patients.
26003269 2015 Antimüllerian hormone levels and antral follicle count as prognostic indicators in a personalized prediction model of live birth.
25972076 2015 Placenta expresses anti-Müllerian hormone and its receptor: Sex-related difference in fetal membranes.
25826396 2015 An analysis of the influence of selected genetic and hormonal factors on the occurrence of depressive symptoms in late-reproductive-age women.
25824010 2015 Anti-Müllerian Hormone in Peritoneal Fluid and Plasma From Women With and Without Endometriosis.
25796318 2015 Role of ovarian reserve markers, antimüllerian hormone and antral follicle count, as aneuploidy markers in ongoing pregnancies and miscarriages.
25790842 2015 AMH and AMHR2 polymorphisms and AMH serum level can predict assisted reproduction outcomes: a cross-sectional study.
25772768 2015 Antimüllerian hormone levels decrease in female-to-male transsexuals using testosterone as cross-sex therapy.
25750103 2015 AMH mutations with reduced in vitro bioactivity are related to premature ovarian insufficiency.
25651719 2014 Basal serum anti-Mullerian hormone (AMH) is a promising test in prediction of occurrence of pregnancy rate in infertile women undergoing ICSI cycles.
25581422 2015 Inhibin B is lower and anti-Müllerian hormone is similar in serum of men with spinal cord injuries compared to controls.
25558667 2014 [Anti-Mullerian hormone in the major phenotypes of polycystic ovary syndrome].
25542251 2015 Single nucleotide polymorphisms in the Anti-Müllerian hormone (AMH Ile(49)Ser) and Anti-Müllerian hormone type II receptor (AMHRII -482 A>G) as genetic markers in assisted reproduction technology.
25500128 2014 Anti Müllerian Hormone (AMH) level and expression in mural and cumulus cells in relation to age.
25488203 2015 Elevated serum thyroid-stimulating hormone is associated with decreased anti-Müllerian hormone in infertile women of reproductive age.
25467043 2015 Each small antral follicle in ovaries of women with polycystic ovary syndrome produces more antimüllerian hormone than its counterpart in a normal ovary: an observational cross-sectional study.
25405500 2015 Reduced serum levels of anti-Müllerian hormone in females with inherited bone marrow failure syndromes.
25337276 2014 Evaluation of serum anti-Mullerian hormone as a biomarker of early ovarian aging in young women undergoing IVF/ICSI cycle.
25329139 2015 The relationship between serum anti-Müllerian hormone levels and the follicular arrest for women with polycystic ovary syndrome.
25322464 2015 Anti-Müllerian hormone regulation by the bone morphogenetic proteins in the sheep ovary: deciphering a direct regulatory pathway.
25241372 2014 Antimüllerian hormone regulates stem cell factor expression in human granulosa cells.
25222840 2015 Change of anti-Mullerian-hormone levels during follicular phase in PCOS patients.
25152514 2014 Anti-Müllerian hormone (AMH) is a strong predictor of live birth in women undergoing assisted reproductive technology.
25086280 2014 AMH: An ovarian reserve biomarker in assisted reproduction.
25040369 2014 Polycystic ovary syndrome and anti-Müllerian hormone: role of insulin resistance, androgens, obesity and gonadotrophins.
25036408 2014 Comparison of serum anti-Müllerian hormone levels in normal weight and overweight-obese adolescent patients with polycystic ovary syndrome.
25026127 2014 Two heterozygous mutations of the AMH gene in a Japanese patient with persistent Müllerian duct syndrome.
25012254 2015 Assessment of FSHR, AMH, and AMHRII variants in women with polycystic ovary syndrome.
25009087 2014 Serum anti-mullerian hormone in reproductive aged women with benign ovarian cysts.
24951363 2014 Toward a better follow-up of ovarian recovery in young women after chemotherapy with a hypersensitive antimüllerian hormone assay.
24912417 2014 AMH and AMHR2 genetic variants in Chinese women with primary ovarian insufficiency and normal age at natural menopause.
24898132 2014 Anti-Mullerian hormone and insulin resistance in polycystic ovary syndrome.
24886254 2014 Anti-mullerian hormone is expressed by endometriosis tissues and induces cell cycle arrest and apoptosis in endometriosis cells.
24746743 2014 Age-specific serum antimüllerian hormone levels in women with and without polycystic ovary syndrome.
24707500 2014 Does loop electrosurgical excision procedure of the uterine cervix affect anti-Müllerian hormone levels?
24666685 2014 Serum AMH level as a marker of acute and long-term effects of chemotherapy on the ovarian follicular content: a systematic review.
24661732 2014 Ovarian morphology assessed by magnetic resonance imaging in women with and without polycystic ovary syndrome and associations with antimüllerian hormone, free testosterone, and glucose disposal rate.
24620523 2013 [Anti-Müllerian hormone serum levels in women with and without uterine fibroids].
24613539 2014 Increased expression of antimüllerian hormone and its receptor in endometriosis.
24593938 2014 Characterization of women with elevated antimüllerian hormone levels (AMH): correlation of AMH with polycystic ovarian syndrome phenotypes and assisted reproductive technology outcomes.
24576226 2014 The rate of high ovarian response in women identified at risk by a high serum AMH level is influenced by the type of gonadotropin.
24424371 2014 Enzyme-linked immunosorbent assay measurements of antimüllerian hormone (AMH) in human blood are a composite of the uncleaved and bioactive cleaved forms of AMH.
24345579 2014 Decreased serum anti-Müllerian hormone levels in girls with newly diagnosed cancer.
24312319 2013 Anti-Müllerian hormone recruits BMPR-IA in immature granulosa cells.
24292596 Association between AMH, oocyte number and availability of embryos for cryopreservation in IVF.
24290000 2014 Decline of serum antimüllerian hormone levels after laparoscopic ovarian cystectomy in endometrioma and other benign cysts: a prospective cohort study.
24219729 2013 Can anti-Müllerian hormone be predictive of spontaneous onset of pregnancy in women with unexplained infertility?
24210790 2014 Evaluation of serum anti-Mullerian hormone levels to assess the ovarian reserve in women with severe endometriosis.
24182412 2014 Race/ethnic disparities in reproductive age: an examination of ovarian reserve estimates across four race/ethnic groups of healthy, regularly cycling women.
24172648 2013 Comparison of serum anti-Mullerian hormone levels following hysterectomy and myomectomy for benign gynaecological conditions.
24146295 2013 Association study of anti-Mullerian hormone and anti-Mullerian hormone type II receptor polymorphisms with idiopathic primary ovarian insufficiency.
24098470 2013 Up-regulation of SOX9 in sertoli cells from testiculopathic patients accounts for increasing anti-mullerian hormone expression via impaired androgen receptor signaling.
24083876 2014 Antimüllerian hormone as a measure of reproductive function in female childhood cancer survivors.
24069435 2013 Prediction of reproductive outcomes according to different serum anti-Müllerian hormone levels in females undergoing intracystoplasmic sperm injection.
24045871 2013 Human blood contains both the uncleaved precursor of anti-Mullerian hormone and a complex of the NH2- and COOH-terminal peptides.
23968732 2013 Pretreatment anti-Müllerian hormone predicts for loss of ovarian function after chemotherapy for early breast cancer.
23928669 2013 Parallel variations of insulin-like peptide 3 (INSL3) and antimüllerian hormone (AMH) in women with the polycystic ovary syndrome according to menstrual cycle pattern.
23876536 2013 Serum antimüllerian hormone in response to dietary management and/or physical exercise in overweight/obese women with polycystic ovary syndrome: secondary analysis of a randomized controlled trial.
23850305 2013 FSHB-211 and FSHR 2039 are associated with serum levels of follicle-stimulating hormone and antimüllerian hormone in healthy girls: a longitudinal cohort study.
23847299 2013 Serum anti-Mullerian hormone (AMH) levels correlate with infrarenal aortic diameter in healthy older men: is AMH a cardiovascular hormone?
23810163 2013 Mullerian inhibiting substance expression in papillary thyroid cancer.
23785020 2013 Growth hormone (GH) activity is associated with increased serum oestradiol and reduced anti-Müllerian hormone in healthy male volunteers treated with GH and a GH antagonist.
23762215 2013 Anti-müllerian hormone is not associated with cardiometabolic risk factors in adolescent females.
23690308 2013 Modifiers of ovarian function in girls and women with classic galactosemia.
23664458 2013 Dehydroepiandrosterone supplementation improves predictive markers for diminished ovarian reserve: serum AMH, inhibin B and antral follicle count.
23640374 2013 The significance of serum anti-Müllerian hormone (AMH) levels in patients over age 40 in first IVF treatment.
23608780 2013 What is the optimal threshold of serum Anti-Müllerian hormone (AMH) necessary for IVM treatments?
23554429 2013 Levels of serum anti-Müllerian hormone, a marker for ovarian reserve, in women with rheumatoid arthritis.
23553200 2013 Anti-Mullerian hormone and insulin resistance in classic phenotype lean PCOS.
23544102 2013 Interactions between genetic variants in AMH and AMHR2 may modify age at natural menopause.
23541317 2013 Antimüllerian hormone, the assessment of the ovarian reserve, and the reproductive outcome of the young patient with cancer.
23533229 2013 Reproductive and lifestyle determinants of anti-Müllerian hormone in a large population-based study.
23533225 2013 Clinical relevance of combined FSH and AMH observations in infertile women.
23509105 2013 The relationship between anti-Müllerian hormone in women receiving fertility assessments and age at menopause in subfertile women: evidence from large population studies.
23461296 2013 Anti-Müllerian hormone and polycystic ovary syndrome: assessment of the clinical pregnancy rates in in vitro fertilization patients.
23452339 2013 AMH after laparoscopic surgery of the ovaries: a review.
23433830 2013 Variation in antimüllerian hormone concentration during the menstrual cycle may change the clinical classification of the ovarian response.
23433069 2013 Analysis of androgen receptor and anti-Müllerian hormone pathways in human granulosa cells under luteinizing hormone treatment.
23419927 2013 Peripubertal changes in circulating antimüllerian hormone levels in girls.
23408576 2013 Antimüllerian hormone levels are strongly associated with live-birth rates after assisted reproduction.
23394782 2013 Antimüllerian hormone in gonadotropin releasing-hormone antagonist cycles: prediction of ovarian response and cumulative treatment outcome in good-prognosis patients.
23390860 2012 [Anti-Mullerian hormone- its role in the pathogenesis of the polycystic ovary syndrome].
23371438 2013 Haplotype analysis of single nucleotide polymorphisms in anti-Müllerian hormone gene in Chinese PCOS women.
23368705 2013 Anti-Müllerian hormone trend after laparoscopic surgery in women with ovarian endometrioma.
23295284 2012 Analysis of anti-Müllerian hormone (AMH) and its receptor (AMHR2) genes in patients with persistent Müllerian duct syndrome.
23051961 2012 Anti-Müllerian hormone level in older women: detection of granulosa cell tumor recurrence.
23044647 2013 Anti-müllerian hormone and ovarian reserve in systemic lupus erythematosus.
23002694 2012 [Anti mullerian hormone (AMH)--is it a new reliable marker of the ovarian reserve? Its role in predicting the ovarian response in assisted reproductive technology (ART)].
22984527 2012 Anti-Müllerian hormone serum values and ovarian reserve: can it predict a decrease in fertility after ovarian stimulation by ART cycles?
22921911 2012 Contribution of the rate of change of antimüllerian hormone in estimating time to menopause for late reproductive-age women.
22910001 2013 High level prokaryotic expression of anti-Müllerian inhibiting substance type II receptor diabody, a new recombinant antibody for in vivo ovarian cancer imaging.
22901847 2012 Serum levels of antimüllerian hormone in early maturing girls before, during, and after suppression with GnRH agonist.
22821432 2012 In women with endometriosis anti-Müllerian hormone levels are decreased only in those with previous endometrioma surgery.
22814098 2013 Serum anti-Mullerian hormone levels affect the rate of ongoing pregnancy after in vitro fertilization.
22771030 2012 Does the level of serum antimüllerian hormone predict ovulatory function in women with polycystic ovary syndrome with aging?
22693172 2012 Anti-Mullerian hormone in the diagnosis of polycystic ovary syndrome: can morphologic description be replaced?
22674205 2012 Quantification of anti-Müllerian hormone (AMH) in dried blood spots: validation of a minimally invasive method for assessing ovarian reserve.
22673409 2012 Differences of the association of anti-Müllerian hormone with clinical or biochemical characteristics between women with and without polycystic ovary syndrome.
22563903 2012 Association between self-reported questionnaire data on fertility and results of hormone analyses in women after childhood cancer: a cross-sectional study.
22552379 2012 Is there any correlation between amh and obesity in premenopausal women?
22545082 2012 Follicle stimulating hormone and anti-Müllerian hormone per oocyte in predicting in vitro fertilization pregnancy in high responders: a cohort study.
22442264 2012 Elimination half-life of anti-Müllerian hormone.
22429116 2012 PCOS and peripheral AMH levels in relation to FSH receptor gene single nucleotide polymorphisms.
22420235 2011 Anti-Müllerian hormone: a unique biochemical marker of gonadal development and fertility in humans.
22405597 2012 Circulating antimüllerian hormone levels in boys decline during early puberty and correlate with inhibin B.
22401810 2012 Assessment of FSHR variants and antimüllerian hormone in infertility patients with a reduced ovarian response to gonadotropin stimulation.
22355044 2012 Ovarian reserve status in young women is associated with altered gene expression in membrana granulosa cells.
22244782 2012 The association between circulating levels of antimüllerian hormone and follicle number, androgens, and menstrual cycle characteristics in young women.
22188863 2011 AMH gene mutations in two Egyptian families with persistent müllerian duct syndrome.
22154766 2012 Androgens and antimüllerian hormone in mothers with polycystic ovary syndrome and their newborns.
22049172 2012 Circulating anti-Mullerian hormone levels in adult men are under a strong genetic influence.
22038452 2012 Serum AMH concentration as a marker evaluating gonadal function in boys operated on for unilateral cryptorchidism between 1st and 4th year of life.
21882017 2011 Serum anti-Müllerian hormone and antral follicle count as predictive markers of OHSS in ART cycles.
21789206 2011 A validated model of serum anti-müllerian hormone from conception to menopause.
21784736 2011 Polycystic ovarian morphology in adolescents with regular menstrual cycles is associated with elevated anti-Mullerian hormone.
21724534 The clinical significance of anti-Müllerian hormone evaluation in gynecological endocrinology.
21719005 2011 Serum anti-Müllerian hormone and inhibin B concentrations are not useful predictors of ovarian response during ovulation induction treatment with recombinant follicle-stimulating hormone in women with polycystic ovary syndrome.
21704216 2011 Serum antimüllerian hormone in healthy premenopausal women.
21576079 2011 Intra-individual stability over time of standardized anti-Mullerian hormone in FMR1 premutation carriers.
21529798 2011 Elevated body mass index is associated with lower serum anti-mullerian hormone levels in infertile women with diminished ovarian reserve but not with normal ovarian reserve.
21514928 2011 Impact of laparoscopic ovarian drilling on anti-Müllerian hormone levels and ovarian stromal blood flow using three-dimensional power Doppler in women with anovulatory polycystic ovary syndrome.
21514585 2011 Follicle-stimulating hormone suppressed excessive production of antimullerian hormone caused by abnormally enhanced promoter activity in polycystic ovary syndrome granulosa cells.
21497340 2011 Random anti-Müllerian hormone (AMH) is a predictor of ovarian response in women with elevated baseline early follicular follicle-stimulating hormone levels.
21486417 2012 Decrease of anti-Mullerian hormone in genetic spermatogenic failure.
21481373 2011 Divergent effects of the 677C>T mutation of the 5,10-methylenetetrahydrofolate reductase (MTHFR) gene on ovarian responsiveness and anti-Müllerian hormone concentrations.
21457958 2011 Age-related normograms of serum antimüllerian hormone levels in a population of infertile women: a multicenter study.
21451424 2011 Predicting age at menopause from serum antimüllerian hormone concentration.
21341396 2011 Correlation between sonographic and endocrine markers of ovarian aging as predictors for late menopausal transition.
21315336 2011 Changes in serum anti-Müllerian hormone levels may predict damage to residual normal ovarian tissue after laparoscopic surgery for women with ovarian endometrioma.
21315333 2011 Antimüllerian hormone as a predictor of controlled ovarian hyperstimulation outcome: comparison of two commercial immunoassay kits.
21300348 2011 Vitrified human ovaries have fewer primordial follicles and produce less antimüllerian hormone than slow-frozen ovaries.
21285453 2011 Inhibin B and anti-Müllerian hormone in spermatic vein of subfertile men with varicocele.
21227943 2011 Circadian variation in concentration of anti-Müllerian hormone in regularly menstruating females: relation to age, gonadotrophin and sex steroid levels.
21227938 2011 Anti-Mullerian hormone in short girls born small for gestational age and the effect of growth hormone treatment.
21177311 2011 Serum anti-Müllerian hormone levels are negatively related to Follicular Output RaTe (FORT) in normo-cycling women undergoing controlled ovarian hyperstimulation.
21168856 2011 Inhibin B and anti-Müllerian hormone as markers of gonadal function after treatment for medulloblastoma or posterior fossa ependymoma during childhood.
21114374 2011 Antimüllerian hormone (AMH) not only a marker for prediction of ovarian reserve.
20864412 2010 Single nucleotide polymorphisms in the anti-Müllerian hormone signalling pathway do not determine high or low response to ovarian stimulation.
20861221 2010 Processing of anti-mullerian hormone regulates receptor activation by a mechanism distinct from TGF-beta.
20843948 2010 Changes in anti-Müllerian hormone (AMH) throughout the life span: a population-based study of 1027 healthy males from birth (cord blood) to the age of 69 years.
20809108 2010 Elevated serum anti-mullerian hormone in adolescent and young adult Chinese patients with polycystic ovary syndrome.
20801125 2010 Development of a second generation anti-Müllerian hormone (AMH) ELISA.
20797903 2010 Normal serum concentrations of anti-Müllerian hormone in women with regular menstrual cycles.
20797901 2010 Follicular-fluid anti-Müllerian hormone concentration is similar in patients with endometriosis compared with non-endometriotic patients.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20719830 2010 Serum levels of anti-Müllerian hormone as a marker of ovarian function in 926 healthy females from birth to adulthood and in 172 Turner syndrome patients.
20309569 2010 Smoking and AMH levels in women with normal reproductive history.
20236105 2010 Association study of four key folliculogenesis genes in polycystic ovary syndrome.
20207725 2010 Anti-Müllerian hormone and polycystic ovary syndrome: a mountain too high?
20155783 2010 Maternal serum anti-Mullerian hormone level is not superior to chronological age in predicting Down syndrome pregnancies.
20150576 2010 Serum anti-mullerian hormone concentrations are elevated in oligomenorrheic girls without evidence of hyperandrogenism.
20064870 2010 Concentrations of anti-Müllerian hormone in fluid from small human antral follicles show a negative correlation with CYP19 mRNA expression in the corresponding granulosa cells.
20060112 2010 Serum antimullerian hormone (AMH) levels are elevated in adolescent girls with polycystic ovaries and the polycystic ovarian syndrome (PCOS).
19940443 2009 Over-expression of Müllerian inhibiting substance mRNA in the Turner syndrome ovary.
19800062 2010 Longitudinal assessment of antimüllerian hormone during pregnancy-relationship with maternal adiposity, insulin, and adiponectin.
19755162 2010 Development of an efficiently cleaved, bioactive, highly pure FLAG-tagged recombinant human Mullerian Inhibiting Substance.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19539911 2009 Bone morphogenetic protein-6 stimulates gene expression of follicle-stimulating hormone receptor, inhibin/activin beta subunits, and anti-Müllerian hormone in human granulosa cells.
19539910 2010 Association study of AMH and AMHRII polymorphisms with unexplained infertility.
19424576 2009 The expression of Müllerian inhibiting substance/anti-Müllerian hormone type II receptor protein and mRNA in benign, borderline and malignant ovarian neoplasia.
19409547 2010 Assay reproducibility and within-person variation of Müllerian inhibiting substance.
19361798 2010 Increased anti-Müllerian hormone and decreased FSH levels in follicular fluid obtained in women with polycystic ovaries at the time of follicle puncture for in vitro fertilization.
19359032 2009 Serum Müllerian Inhibiting Substance/anti-Müllerian hormone levels in patients with adult granulosa cell tumors directly correlate with aggregate tumor mass as determined by pathology or radiology.
19345350 2010 Impact of laparoscopic cystectomy on ovarian reserve: serial changes of serum anti-Müllerian hormone levels.
19342396 2009 Anti-Müllerian hormone concentrations in androgen-suppressed women with polycystic ovary syndrome.
19217095 2009 Comparing anti-Müllerian hormone (AMH) and follicle-stimulating hormone (FSH) as predictors of ovarian function.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19056816 2009 Interaction of the vitamin D receptor with a vitamin D response element in the Mullerian-inhibiting substance (MIS) promoter: regulation of MIS expression by calcitriol in prostate cancer cells.
18930217 2009 Variations in serum müllerian inhibiting substance between white, black, and Hispanic women.
18930199 2009 Assessment of ovarian function with anti-Müllerian hormone in systemic lupus erythematosus patients undergoing hematopoietic stem cell transplant.
18854109 2008 Growth differentiation factor-9 and anti-Müllerian hormone expression in cultured human follicles from frozen-thawed ovarian tissue.
18784351 2009 Anti-mullerian hormone is an endocrine marker of ovarian gonadotropin-responsive follicles and can help to predict superovulatory responses in the cow.
18697861 2008 Anti-Mullerian hormone, its receptor, FSH receptor, and androgen receptor genes are overexpressed by granulosa cells from stimulated follicles in women with polycystic ovary syndrome.
18593767 2008 Anti-mullerian hormone and inhibin B in the definition of ovarian aging and the menopause transition.
18555223 2009 Correlation of antimüllerian hormone and baseline follicle-stimulating hormone levels.
18381582 2008 Concentration of anti-Müllerian hormone and inhibin-B in relation to steroids and age in follicular fluid from small antral human follicles.
18328480 2009 Evidence for a Müllerian-inhibiting substance autocrine/paracrine system in adult human endometrium.
18321493 2009 The role of antimullerian hormone in prediction of outcome after IVF: comparison with the antral follicle count.
18310677 2008 Anti-Mullerian hormone indicates early ovarian decline in fragile X mental retardation (FMR1) premutation carriers: a preliminary study.
18291376 2008 Anti-Müllerian hormone and inhibin B as predictors of pregnancy after treatment by in vitro fertilization/intracytoplasmic sperm injection.
18249391 2009 Clinical uses of anti-Müllerian hormone assays: pitfalls and promises.
18249372 2008 Follicular fluid anti-Müllerian hormone and inhibin B concentrations: comparison between gonadotropin-releasing hormone (GnRH) agonist and GnRH antagonist cycles.
18230658 2008 A functional anti-mullerian hormone gene polymorphism is associated with follicle number and androgen levels in polycystic ovary syndrome patients.
18191888 2008 Evaluation of different markers of the ovarian reserve in patients presenting with premature ovarian failure.
17926161 2008 Serum anti-Müllerian hormone levels differentiate control from subfertile men but not men with different causes of subfertility.
17636279 2007 A polymorphism in the AMH type II receptor gene is associated with age at menopause in interaction with parity.
17628551 2008 Increased intrafollicular androgen levels affect human granulosa cell secretion of anti-Müllerian hormone and inhibin-B.
17624337 2008 Decreased anti-Müllerian hormone and altered ovarian follicular cohort in infertile patients with mild/minimal endometriosis.
17603052 2008 Statistically significant changes of antimüllerian hormone and inhibin levels during the physiologic menstrual cycle in reproductive age women.
17559842 2007 Mullerian Inhibiting Substance is an ovarian growth factor of emerging clinical significance.
17543956 2008 Anti-Müllerian hormone substance from follicular fluid is positively associated with success in oocyte fertilization during in vitro fertilization.
17488788 2007 Anti-Müllerian hormone levels in peripubertal daughters of women with polycystic ovary syndrome.
17485437 2007 Stable serum levels of anti-Müllerian hormone during the menstrual cycle: a prospective study in normo-ovulatory women.
17462637 2007 Serum anti-Müllerian hormone and inhibin B in disorders of spermatogenesis.
17425826 2007 Müllerian inhibiting substance is an accurate marker of ovarian response in women of advanced reproductive age undergoing IVF.
17337470 2007 Anti-Müllerian hormone and anti-Müllerian hormone type II receptor polymorphisms are associated with follicular phase estradiol levels in normo-ovulatory women.
17335955 2007 Anti-Müllerian hormone levels during hormonal contraception in women with polycystic ovary syndrome.
17088539 2006 Mullerian Inhibiting Substance enhances subclinical doses of chemotherapeutic agents to inhibit human and mouse ovarian cancer.
16923748 2006 Serum anti-Mullerian hormone throughout the human menstrual cycle.
16816803 2006 Testicular anti-Müllerian hormone: history, genetics, regulation and clinical applications.
16740653 2006 Mullerian inhibiting substance regulates androgen-induced gene expression and growth in prostate cancer cells through a nuclear factor-kappaB-dependent Smad-independent mechanism.
16566934 2006 Elevated serum müllerian-inhibiting substance may be a marker for ovarian hyperstimulation syndrome in normal women undergoing in vitro fertilization.
16368745 2006 Serum anti-Mullerian hormone as a surrogate for antral follicle count for definition of the polycystic ovary syndrome.
16213847 2005 Serum Müllerian-inhibiting substance levels in adolescent girls with normal menstrual cycles or with polycystic ovary syndrome.
16159935 2005 High GATA-4 expression associates with aggressive behavior, whereas low anti-Müllerian hormone expression associates with growth potential of ovarian granulosa cell tumors.
16030171 2005 Anti-müllerian hormone protein expression is reduced during the initial stages of follicle development in human polycystic ovaries.
15897891 2005 Role of type I receptors for anti-Müllerian hormone in the SMAT-1 Sertoli cell line.
15550498 2005 DNA sequence variations of the entire anti-Mullerian hormone (AMH) gene promoter and AMH protein expression in patients with the Mayer-Rokitanski-Kuster-Hauser syndrome.
15536161 2005 Testicular anti-mullerian hormone secretion is stimulated by recombinant human FSH in patients with congenital hypogonadotropic hypogonadism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15217995 2004 Changes in anti-Müllerian hormone serum concentrations over time suggest delayed ovarian ageing in normogonadotrophic anovulatory infertility.
15070957 2004 Inhibin B and anti-Müllerian hormone, but not testosterone levels, are normal in infants with nonmosaic Klinefelter syndrome.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14750901 2004 The anti-Müllerian hormone type II receptor: insights into the binding domains recognized by a monoclonal antibody and the natural ligand.
14742691 2004 Anti-Müllerian hormone expression pattern in the human ovary: potential implications for initial and cyclic follicle recruitment.
14715867 2004 Anti-Müllerian hormone serum concentrations in normoovulatory and anovulatory women of reproductive age.
14695376 2004 Requirement of Lim1 for female reproductive tract development.
14671316 2003 Mullerian Inhibiting Substance inhibits cervical cancer cell growth via a pathway involving p130 and p107.
14671196 2003 Elevated serum level of anti-mullerian hormone in patients with polycystic ovary syndrome: relationship to the ovarian follicle excess and to the follicular arrest.
12834017 2003 Sexual differentiation.
12571168 2003 Serum anti-Müllerian hormone is more strongly related to ovarian follicular status than serum inhibin B, estradiol, FSH and LH on day 3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12477536 2002 Mutational analysis of the müllerian-inhibiting substance gene and its receptor gene in Japanese women with polycystic ovary syndrome and premature ovarian failure.
12462075 2002 [Genetics and molecular pathology of anti-Mullerian hormone and its receptor].
12456604 2002 Serum anti-Müllerian hormone levels: a novel measure of ovarian reserve.
11773638 2002 Mullerian-inhibiting substance regulates NF-kappa B signaling in the prostate in vitro and in vivo.
11760020 2001 A novel mutation in the anti-müllerian hormone gene as cause of persistent müllerian duct syndrome.
11420127 2001 Anti-Müllerian hormone and its receptors.
9713320 1998 New insights into mullerian inhibiting substance and its mechanism of action.
8895659 1996 Genetic analysis of the Müllerian-inhibiting substance signal transduction pathway in mammalian sexual differentiation.
8889695 Molecular biology of MIS and its receptors.
8872466 1996 A 27 base-pair deletion of the anti-müllerian type II receptor gene is the most common cause of the persistent müllerian duct syndrome.
8755541 1996 Bioactivation of Müllerian inhibiting substance during gonadal development by a kex2/subtilisin-like endoprotease.
8596488 1996 Reduction of epidermal growth factor receptor phosphorylation by activated Mullerian inhibiting substance is vanadate-sensitive.
8162013 1994 Molecular genetics of the persistent müllerian duct syndrome: a study of 19 families.
3754790 1986 Isolation of the bovine and human genes for Müllerian inhibiting substance and expression of the human gene in animal cells.
3028714 1987 Mapping of the gene for anti-müllerian hormone to the short arm of human chromosome 19.
2974034 1988 Proteolytic processing of mullerian inhibiting substance produces a transforming growth factor-beta-like fragment.
2467567 1988 A monoclonal antibody against human testicular anti-müllerian hormone.
2325025 1990 Expression of the gene for anti-Müllerian hormone.
2023927 1991 Anti-Müllerian hormone Bruxelles: a nonsense mutation associated with the persistent Müllerian duct syndrome.
1750488 1991 Cellular localization of müllerian inhibiting substance messenger ribonucleic acid during human ovarian follicular development.
1483695 1992 Variants of the anti-Müllerian hormone gene in a compound heterozygote with the persistent Müllerian duct syndrome and his family.