Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.82
PubTator Score 0.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adrenocortical carcinoma -2.973 2.5e-05
intraductal papillary-mucinous adenoma (... -1.200 1.6e-03
intraductal papillary-mucinous carcinoma... -1.100 1.2e-02
osteosarcoma -1.152 1.1e-04
ovarian cancer -1.100 2.2e-08

Gene RIF (1)

AA Sequence

MASGHSLLLENAQQVVLVCARGERFLARDALRSLAVLEGASLVVGKDGFIKAIGPADVIQRQFSGETFEE      1 - 70
IIDCSGKCILPGLVDAHTHPVWAGERVHEFAMKLAGATYMEIHQAGGGIHFTVERTRQATEEELFRSLQQ     71 - 140
RLQCMMRAGTTLVECKSGYGLDLETELKMLRVIERARRELDIGISATYCGAHSVPKGKTATEAADDIINN    141 - 210
HLPKLKELGRNGEIHVDNIDVFCEKGVFDLDSTRRILQRGKDIGLQINFHGDELHPMKAAELGAELGAQA    211 - 280
ISHLEEVSDEGIVAMATARCSAILLPTTAYMLRLKQPRARKMLDEGVIVALGSDFNPNAYCFSMPMVMHL    281 - 350
ACVNMRMSMPEALAAATINAAYALGKSHTHGSLEVGKQGDLIIINSSRWEHLIYQFGGHHELIEYVIAKG    351 - 420
KLIYKT                                                                    421 - 426
//

Text Mined References (7)

PMID Year Title