Property Summary

NCBI Gene PubMed Count 443
PubMed Score 2621.65
PubTator Score 1838.90

Knowledge Summary

Patent (521,333)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.161 2.2e-06
lung cancer -2.000 7.2e-04
non primary Sjogren syndrome sicca -1.300 2.3e-02
Breast cancer -1.200 4.0e-20
ovarian cancer -1.100 6.5e-04
pituitary cancer -1.900 1.1e-07

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (422)

PMID Text
26966027 Data show that anaplastic lymphoma kinase (ALKinhibitor ASP3026 was well tolerated with no treatment-related deaths.
26951079 Studies indicate the role of anaplastic lymphoma kinase (ALK) in malignant proliferation and as a valid drug target.
26857243 TERT promoter mutation is an independent predictor for distant metastasis of thyroid neoplasms, but ALK testing is not useful for clinical decision-making in Korean patients with a high prevalence of the BRAF V600E mutation.
26825369 Meta-analysis: immunohistochemistry assay using D5F3 and 5A4 antibodies reliably detected NSCLC with ALK rearrangement and may be useful as a screening method to identify these tumors.
26823889 Case Report: Epithelioid inflammatory myofibroblastic sarcoma treated with ALK inhibitor.
26755435 This review describes the biology of EML4 and ALK, explains the main features of EML4-ALK fusion proteins and outline the therapies that target EML4-ALK in cancer. [review]
26719536 Rather than by secondary ALK mutations.
26687816 ALK activation in tumors was associated with favorable features, including a younger age at diagnosis, hyperdiploidy, and detection by mass screening
26630010 Data show FAM150B, which was named as augmentor-alpha (AUG-alpha), binds and activtes both anaplastic lymphoma kinase (ALK) and tyrosine kinase (LTK).
26618223 We will also provide a timely review on all ALK inhibitors and their current status of development in clinical settings
26581482 Data show that 11/105 patients failed all molecular analysis: no mutations in oncogenes EGFR, KRAS and NRAS were detected, and no ALK gene rearrangements or MET gene amplifications were identified.
26568289 report the development of a structural analogue of alectinib (JH-VIII-157-02) that is potent against the G1202R Anaplastic Lymphoma Kinase mutant as well as a variety of other frequently observed mutants.
26555338 COPD-related NSCLC patients exhibited low prevalences of EGFR mutations and ALK rearrangements compared with the non-COPD group. Further studies are required regarding the molecular mechanisms underlying lung cancer associated with COPD
26544515 Data suggest that platelets are a valuable source for the non-invasive detection of echinoderm microtubule associated protein like 4-anaplastic lymphoma kinase (EML4-ALK) rearrangements and for predicting and monitoring outcome to crizotinib.
26537995 the discovery of EGFR mutations and ALK rearrangements has enabled the identification of patients who are more likely to benefit from a specific drug.
26517679 Data show that inhibition of echinoderm microtubule-associated protein-like 4 (EML4)-anaplastic lymphoma kinase (ALK)-mediated stem-like properties enhances the anti-tumor effect.
26505450 Data identified several cases of complex EGFR mutations, and concomitant EGFR mutations and ALK rearrangements in non-small cell lung cancer
26444240 findings suggest a novel mechanism of oncogene activation in cancer through de novo alternative transcription initiation, such as for ALK
26422230 Intratumor Heterogeneity of ALK-Rearrangements and Homogeneity of EGFR-Mutations in Mixed Lung Adenocarcinoma
26418745 In conclusion, these data show that ALK is robustly activated by the FAM150A/B ligands.
26416997 Intratumoral genetic heterogeneity was demonstrated to coexist with histologic heterogeneity in both single-driver and ALK/EGFR coaltered lung adenocarcinomas (LADCs).
26384210 ALK is overexpressed in a substantial proportion of breast cancers.
26379151 Report morphologic features of ALK-negative anaplastic large cell lymphomas with DUSP22 gene rearrangements.
26338968 Results suggest that co-treatment with crizotinib and chloroquine could be beneficial for ALK-positive ALK-positive anaplastic large cell lymphoma patients.
26314227 Cystic Brain Metastases Occurring in Anaplastic Lymphoma Kinase Gene Rearranged Non-Small-Cell Lung Cancer Patients Receiving Crizotinib.
26299615 Suggest novel small molecule ALK inhibitors combined with RNA interfering based nanoliposomes in treatment of neuroblastomas.
26295973 Anaplastic lymphoma kinase (ALK) rearrangements in medullary thyroid cancer.
26276782 anaplastic lymphoma kinase immunohistochemistry should be carried out to assess this diagnosis when spindle cell proliferations are observed
26223379 Studies suggest that the presence of dual specificity phosphatase 22 (DUSP22) and p63 tumor suppressor protein (TP63) rearrangements might be useful to support a diagnosis of anaplastic lymphoma kinase (ALK)-negative anaplastic large cell lymphoma (ALCL).
26172300 analysis of ALK rearrangement in colorectal adenocarcinoma by immunohistochemistry screening
26152804 ALK and ROS1 rearrangements found in advanced non-small cell lung cancer patients
26147305 data, hence, provided evidences of a potentially active role of ALK in RMS cells, but also suggest caution in considering ALK a major therapeutic target in this malignancy
26121314 Gene fusions involving the ALK gene occurs in epithelioid forms of benign fibrous histiocytoma.
26067621 Non-CpG methylation observed essentially in clinically favorable cases was associated with the differentiation status of neuroblastoma and expression of key genes such as ALK.
26059187 These findings are of clinical importance given the potential role of ALK mutations in clonal evolution and relapse.
26045865 Case Report: lung adenocarcinoma with different histological types between primary tumor and metastasis, but both haboring ALK-rearrangement.
26032424 we propose that tumors harboring ALK mutations may be therapeutically tractable for personalized treatment of certain aggressive leukemias with ALK inhibitors.
26019170 We further showed that both EML4-ALK and mutant forms of EGFR modulate PD-L1 expression via common downstream pathways mediated by MEK-ERK and by PI3K-AKT.
25975837 ALK-negative anaplastic large cell lymphoma is sensitive to bortezomib through Noxa upregulation and release of Bax from Bcl-2.
25967762 Immunohistochemistry performed on FNA smears using the cell transfer technique is an alternative method for the assessment of ALK rearrangement.
25966792 Crizotinib was well tolerated and showed promising efficacy in Chinese patients with ALK-positive, advanced NSCLC.
25964588 Such a complex diagnostic genetic profile has not been reported in ALK fusion-positive NSCLC. This case highlights the utility of comprehensive molecular testing in the diagnosis of NSCLC.
25929957 analysis of anaplastic lymphoma kinase (ALK) gene rearrangements in lung adenocarcinoma
25857825 the majority of epithelioid fibrous histiocytomas demonstrate ALK expression and ALK gene rearrangement. ALK expression is not seen in other variants of fibrous histiocytoma.
25855381 our findings indicate that LADCs with ALK, RET, and ROS1 fusions develop exclusively via their dependence on these oncogene fusions.
25813404 The combination of 2 different PCR tests is a viable approach for the diagnostics of ALK rearrangements.
25813151 KRAS and EGFR co-mutation was detected in one case. PPMA patients with ALK rearrangements or KRAS mutation represent a unique subtype in Non-Small-Cell Lung Carcinoma
25803816 This study shows a significant presence of ALK copy number gain in inflammatory breast cancer patients, and ALK copy number gain was associated with significantly poorer recurrence free survival.
25795305 By combining karyotyping and RNA sequencing, we identified the 2 first ever reported anaplastic lymphoma kinase gene rearrangements in central nervous system tumors.
25789835 The novel 1A4 antibody represents a promising candidate for screening lung tumors for the presence of ALK rearrangements.
25789833 Our findings show good correlation between FISH versus CISH in the detection of ALK and ROS1 rearrangements. FISH versus IHC showed good correlation in the detection of ALK rearrangements
25740311 We have determined crystal structures of the coiled-coils from EML2 and EML4, which describe the structural basis of both EML self-association and oncogenic EML4-ALK activation.
25736571 ALK I1171 mutation confers resistance to alectinib.
25735977 H1299 NSCLC cells stably expressing EML4-ALK acquire epithelial-mesenchymal transition (EMT) phenotype, associated with enhanced invasive migration and increased expression of EMT-inducing transcription factors.
25723109 inflammatory myofibroblastic tumors with frequent ALK and ROS1 gene fusions
25714698 Besides well-recognized ALK gene rearrangement, ALK gene amplification and mutations are common in many human cancers.
25708242 ALK expression was correlated with ALK translocation, but not with ALK gene copy number gain. ALK translocation was also mutually exclusive with EGFR mutation in Taiwanese non-small cell lung cancer
25706305 It was revealed that the EML4-ALK fusion gene was observed predominantly in adenocarcinoma, non-smoking and non-small-cell lung cancers (NSCLC) patients, especially those diagnosed in the advanced clinical stage of NSCLC.
25683346 ALK protein expression, phosphorylation, and genetic aberrations was measured by the FISH technique in 81 soft tissue tumor samples. ALK-phosphorylation-positive cases showed a statistically worse metastasis-free survival.
25682942 ALK fusion with FN1 gene resulting in ALK overexpression is associated with inflammatory myofibroblastic tumor.
25682925 Brain metastases are frequent in advanced EGFR-mutated or ALK-rearranged non-small-cell lung cancers.
25674293 Case Report: ALK-positive ALCL displaying an unusual alveolar growth pattern.
25652313 this study concludes that the novel mechanism would regulate the expression of ALK in neuroblastoma and that NeuroD1 should be significantly involved in neuroblastoma tumorigenesis.
25605972 Heparin is an activating ligand of the orphan receptor tyrosine kinase ALK.
25602801 In addition to ALK fusions previously described in other tumor types (NPM1-ALK, TPR-ALK), we identified 2 novel ALK fusions (CLIP1-ALK and GTF3C2-ALK) in our cohort of Spitz tumors
25596129 Western blot showed phosphorylation of ALK, ERK1/2, and STAT3 in cells transfected with TPM3-ALK. Coiled-coil structure of TPM3 contributes to the transforming ability of the TPM3-ALK fusion protein, and longer TPM3 region leads to higher dimer formation.
25577516 The ALK gene fuses with echinoderm microtubule-associated protein-like 4 in the majority of ALK-positive lung cancer cases.
25576649 ALK gene rearrangement is associated with non-small cell lung carcinoma.
25575117 Adenocarcinomas with ALK rearrangement appeared as solid masses with lobulated margins at CT, were more likely to be associated with lymphangitic metastasis, advanced ln metastasis, and pleural/ pericardial metastasis than were tumors with EGFR mutations.
25557162 ALK gene rearrangement is associated with lung adenocarcinomas.
25529354 detection of ALK rearrangement when tumor tissue is not available. The Ventana ALK IHC assay is an effective screening method for ALK rearrangement in MPE cell blocks from patients with advanced NSCLC, demonstrating high agreement with FISH results
25527865 ALK protein expression is not a rare molecular event in lung squamous cell carcinoma.
25527510 Authors developed a system to detect rearrangement of ALK in a large group of Korean thyroid cancer patients. We screened 474 malignant or benign thyroid tumor cases to identify ALK fusions.
25517749 ALK genomic status is a clinically important therapeutic stratification tool in neuroblastoma.
25514802 Difficulties in ALK FISH signal interpretation might be bypassed using this detailed scoring system, which is highly reproducible, helps clarify borderline samples (according to split type).
25501013 We conclude that 2.2% of papillary thyroid carcinomas are ALK-translocated
25434695 These findings should assist clinicians in assessing the likelihood of EML4-ALK rearrangements and EGFR mutations and understanding their biological implications in NSCLC.
25421750 Study of anaplastic Large Cell Lymphoma resistant to ALK Inhibitor AP26113 identified point mutations in ALK kinase domain generating amino acid substitutions.
25413595 Results show that gene rearrangement in ALK protein lead to gene fusion which results in benign fibrous histeocytoma
25393796 Two patients with non-small-cell lung cancer developed acquired resistance to alectinib with the presence of a mutation in amino acid residue 1171 located in the hydrophobic regulatory spine of the ALK kinase.
25393795 ALK rearrangement was found in 35 patients (3.2%). Cytological samples (using either direct smears or cell blocks), were more frequently non-assessable than histological samples (69% versus 89%, respectively) (p < 0.001).
25351247 The kinase ALK stimulates the kinase ERK5 to promote the expression of the oncogene MYCN in neuroblastoma.
25312988 ALK positive lung adenocarcinomas are more likely than EGFR mutant lung adenocarcinomas to be associated with larger volume, multifocal thoracic lymphadenopathy.
25270523 Anaplastic lymphoma kinase translocation was found in sarcomatoid carcinoma of the head and neck.
25228590 Targeting mTORC1 in combination with ALK leads to enhanced antitumor efficacy and prolongs survival in mouse xenograft models of human neuroblastoma coexpressing ALKF1174L and MYCN.
25228534 study identified a novel V1180L gatekeeper mutation from the cell line model and a second novel I1171T mutation from the non-small cell lung cancer patient who developed resistance to alectinib; both ALK mutations conferred resistance to alectinib as well as to crizotinib, but were sensitive to ceritinib and other next-generation ALK-TKIs
25193384 we uncovered an ALK-specific regulation of the hypoxia response across different ALK(+) tumor types and propose HIFs as a powerful specific therapeutic target in ALK-rearranged ALCL and NSCLC.
25145835 findings uncover the oncogenic role of the JUNB/CD30 axis and its potential as therapeutic target in ALK+ ALCL.
25144242 Results suggested that chromothripsis may be a mechanism of oncogenic rearrangement of EML4-ALK.
25083769 ALK genomic alterations are rare and probably without prognostic implications in UC.
25071110 In neuroblastoma, subclonal ALK mutations can be present at diagnosis with subsequent clonal expansion at relapse.
25028527 Letter/Case Report: lung adenocarcinoma where EML4-ALK gene rearrangement was missed by FISH techniques but detected using reverse transcriptase PCR.
25017418 All other 94 cases showed no ALK expression.
24982409 NSCLC patients with the EML4-ALK fusion gene might be relatively insensitivite to cytotoxic chemotherapy.
24952482 Results suggest that heat shock protein 90 (Hsp90) inhibitors may overcome ligand-triggered resistance in microtubule associated protein-like 4 (EML4)--anaplastic lymphoma kinase (ALK) lung cancer cells.
24952065 Report stable binding of crizotinib with the native-type ALK in comparison to the mutant, drug resistant type ALK.
24947326 data strongly support a role for ALK-wt, in addition to ALK-F1174L and ALK-R1275Q, to confer in vitro and in vivo tumorigenic properties on neural crest progenitor cells
24942490 ALK fusion is an infrequent alteration in Finnish non-small cell lung cancer patients.
24935562 EGFR gene mutations and the EML4-ALK fusion gene were detected in 92 lung adenocarcinoma patients in China.
24899136 ALK fusion-positive lung lesions were significantly smaller and had a lower tumor disappearance rate than ALK fusion-negative lesions when using high-resolution computed tomography.
24894770 performed immunohistochemistry and fluorescence in situ hybridization on 73 ALK-negative anaplastic large cell lymphomas (ALCLs) and 32 ALK-positive ALCLs and evaluated the associations among pathology, genetics, and clinical outcome
24888607 Simultaneous panel genotyping revealed more prevalent ALK rearrangements than reported in previous studies and their strong association with advanced stage irrespective of sex or smoking history.
24885982 ALK+ NSCLC has distinct characteristics at CT imaging that, when combined with clinical covariates, discriminate ALK+ from non-ALK tumors and can potentially identify patients with a shorter durable response to crizotinib.
24885886 ALK rearrangement is rare in lung cancer with nodular ground-glass opacity, but is associated with advanced stage and larger tumor size, suggesting its association with aggressive progression of lung adenocarcinoma.
24885803 Of the 523 NSCLC specimens, 20 (3.8%) were positive for ALK rearrangement by FISH analysis. EGFR and KRAS mutations were identified in 70 (13.4%) and 124 (23.7%) of the 523 tumor samples, respectively.
24878018 identification of ALK rearrangements in non-small cell lung cancer
24846683 This is the first report of ALK rearrangement in an octogenarian patient with pleomorphic carcinoma of the lung.
24830726 Flotillin-1 regulates oncogenic signaling in neuroblastoma cells by regulating ALK membrane association.
24815447 ALK rearrangement is a prognostic factor of tumor recurrence in completely resected non-small cell lung cancer of any stage.
24785465 Data indicate 2,4-diarylaminopyrimidine analogues as potent inhibitors against both wild-type and mutant anaplastic lymphoma kinase (ALK) kinases.
24778081 Our preliminary data exclude the utility of analysis of the ALK gene in malignant mesothelioma
24775606 ALK translocation, occurring at a frequency of 6.8% in Chinese patients, defines a unique molecular subgroup of lung tumors.
24750504 data argue against PDGFRB activation in association with ALK gene aberrations in metastatic NSCLC and seem to imply differential pathobiological roles of ALK alterations in lung cancer and lymphoma, possibly depending on different fusion partner genes.
24736082 TPR-ALK fusion is associated with lung adenocarcinoma.
24736079 ALK G1202R mutation confers high-level resistance to alectinib in ALK-rearranged non-small-cell lung cancer patients who progressed on crizotinib.
24736067 ALK gene rearrangements are associated with lung cancer.
24722154 Our study demonstrated for the first time that MET receptor expression, but not MET gene amplification, is significantly increased in ALK(+) NSCLC
24706829 Hsp90-sensitive EML4-ALK variants are exceptions to the rule that oncogenic fusion proteins involve breakpoints in disordered regions of both partners
24698967 Spitz nevi/tumors with ALK rearrangement show a characteristic plexiform morphology and that ALK immunohistochemistry and FISH enable the accurate identification of this morphologic and genetic distinct subset of spitzoid neoplasms.
24698962 Case Report: VCL-ALK gene fusion in renal cell carcinoma in patient with sickle cell trait.
24691006 the outcome of 68 patients with advanced colorectal cancer and RAS, BRAF and PI3KCA status according to ALK gene status, is reported.
24687827 Case Report: ALK-Rearranged anaplastic thyroid carcinoma treated with crizotinib.
24648382 Anaplastic lymphoma kinase gene rearrangements is associated with non-small cell lung cancer.
24633422 ALK translocation is a therapeutiv target for the treatment of aggressive papillary cancer of the thyroid.
24629636 ALK, ROS1 and RET fusions are associated with pathological features of lung adenocarcinoma and are more prevalent in solid-predominant adenocarcinoma.
24613930 Our data demonstrate that STRN-ALK fusion occurs in a subset of patients with highly aggressive types of thyroid cancer and provide initial evidence suggesting that it may represent a therapeutic target for these patients.
24613277 RANBP2-ALK fusion combined with monosomy 7 may be related to a unique clonal hematologic disorder of childhood and adolescence, characterized by myelomonocytic leukemia and a poor prognosis [case report/ review]
24518095 ALK rearrangement is associated with crizotinib responsiveness in non-small-cell lung cancer.
24518086 ALK rearrangement is associated with non-small-cell lung cancers.
24509625 Activating mutations in ALK kinase domain confer resistance to structurally unrelated ALK inhibitors in NPM-ALK-positive anaplastic large-cell lymphoma.
24495999 ALK rearrangement and transcriptional up-regulation is associated with non-small-cell lung cancers.
24478382 Different levels of ALK expression can be found in various cancer types. ALK fusion is a rare event in human solid cancers.
24475247 A recurrent STRN/ALK fusion found in thyroid carcinomas.
24470379 analysis of the RANBP2-ALK gene fusion identified in ALK-positive diffuse large B-cell lymphoma with a unique nuclear membrane staining of ALK protein
24462463 poorer disease-free survival in fusion-positive lung adenocarcinoma patients after curative surgery
24443522 ALK rearrangements and EGFR mutations could coexist in a small subgroup of NSCLC.
24442099 The ALK rearrangements are independently associated with younger age and the EGFR wild type. The EGFR mutations and the ALK rearrangements are rarely coexistent. The ALK rearrangements and the KRAS mutations are mutually exclusive.
24419423 ALK kinase splicing isoform is not associated with non-small-cell lung cancer.
24419060 Findings indicate that ASP3026 has potential efficacy for non-small cell lung cancer (NSCLC) and is expected to improve the therapeutic outcomes of patients with cancer with anaplastic lymphoma receptor tyrosine kinase (ALK) abnormality.
24415871 ALK copy number gain is present in hepatocellular carcinoma and may be an unfavorable prognostic predictor.
24403104 ALK-positive patients have a good response to first-line cytotoxic drugs and to crizotinib as second-line therapy, but a relatively poor response to cytotoxic drugs as second-line therapy.
24389447 ALK rearrangement is associated with response to chemotherapy in brain metastases of non-small-cell lung cancer.
24389446 ALK 2p23 fusion and rearrangement is associated with response to chemotherapy in Choroidal metastases.
24389444 Increased ALK gene copy number is associated with response to chemotherapy in lung adenocarcinoma.
24389440 ALK gene rearrangement is associated with spinal cord metastasis and leptomeningeal carcinomatosis in non-small-cell lung cancer.
24388371 EML4-ALK fusion genepositivitymightbe higher inyoungerNSCLCpatientswithwild-type EGFR.
24356251 ALK is a MYCN target gene and regulates cell migration and invasion in neuroblastoma
24346098 EML4-ALK fusion is uncommon, reported in about 5% of NSCLC patients.
24300132 gene rearrangement has no prognostic relevance in patients with resected non-small cell lung cancer
24293609 Chromogenic in situ hybridisation is a very reliable, convenient and inexpensive method to detect ALK-positive non-small cell lung carcinomas.
24288180 Crizotinib is the standard of care in terms of the treatment of patients with ALK-positive, advanced NSCLC.
24277751 This case suggests that echinoderm microtubule-associated protein-like 4-anaplastic lymphoma kinase fusion is an oncogenic event in not only carcinomas but also sarcomas originating from stromal cells.
24276038 ALK copy number gain is associated with metachronous neuroblastoma.
24228132 Case Report: anaplastic lymphoma kinase-positive large B-cell lymphoma diagnosed using cytological features of the pleural effusion.
24218456 Activity of NPM/ALK chimeric protein closely resembles cell activation induced by IL-2. 67% of the affected genes were modulated in common by NPM/ALK & IL-2, especially those involved in Jak/STAT- & IL-2-signaling pathways.
24200637 Data indicate that coexistence of EML4-ALK fusion or ALK copy number increase and EGFR, MET, and KRAS mutations in tumor tissue from two treatment-naive Chinese non-small cell lung cancer (NSCLC) patients.
24192124 EGFR mutation as well as KRAS and ALK rearrangements are important biomarkers in the field owing to potential targeted therapies involved in clinical practice
24149177 Quantitative assessment of ALK mRNA expression helps to improve risk stratification of rhabdomyosarcoma patients and identifies tumours with adverse biological characteristics and aggressive behaviour.
24129244 A potential role of targeting ALK in advanced colorectal carcinomas by using ALK FISH and ALK immunohistochemistry as a screening tool to detect ALK alterations.
24060861 ALK activation in cancer can arise from translocations creating oncogenic fusion proteins or through overexpression & mutation of full-length ALK. Review.
23991058 Data indicate that expression of several predicted chimeric genes and genes with disrupted exon structure including ALK, NBAS, FHIT, PTPRD and ODZ4 in neuroblastoma.
23988776 in lung adenocarcinomas, KRAS mutations are prevalent in male smokers; EGFR mutations are associated with female sex, nonsmoking and lepidic and micropapillary growth; TTF1 has a role in survival; BRAF mutations have roles in survival
23975180 STAT3-mediated activation of microRNA cluster 17~92 promotes proliferation and survival of ALK-positive anaplastic large cell lymphoma.
23951022 Data indicate that all of the 8 patients with high abundance of Echinoderm microtubule-associated protein-like 4- anaplastic lymphoma kinase (EML4-ALK) positive cells in tumor tissues were also have high expression of ALK protein.
23932486 The frequencies of somatic EGFR, KRAS, and ALK gene abnormalities reflect the diverse ethnicity and smoking patterns of non-small-cell lung cancers patients in the United States.
23922677 44 cases of ALK-rearranged samples were identified by fluorescent in-situ hybridization (FISH), immunohistochemistry (IHC), and reverse transcription polymerase chain reaction (RT-PCR) in a large number of surgically resected lung cancers
23922356 ALK protein expression is statistically associated with alveolar rhabdomyosarcoma histology, metastatic disease at diagnosis and primary trunk site
23919423 evaluated mutations in four driver genes, epidermal growth factor receptor (EGFR), Kirsten ras oncogene (KRAS), c-MET, and echinoderm microtubule-associated protein-like 4-anaplastic lymphoma kinase (EML4-ALK), in Chinese lung adenocarcinoma patients
23887300 EML4-ALK gene rearrangements do not appear to be involved in the development of primary adenocarcinoma of the urinary bladder.
23867124 Report co-expression of IGF-1R and ALK in embryonal and alveolar rhabdomyosarcoma and suggest both as possible drug targets.
23851431 Data indicate that anaplastic lymphoma kinase (ALK) expression is uncommon in both pancreatic ductal adenocarcinoma and neuroendocrine tumors, and that ALK is not induced by translocation, and is unlikely to be a therapeutic target.
23814019 NPM-ALK-mediated phosphorylation of PKM2 and metabolic reprogramming has a role in anaplastic large cell lymphoma
23797004 ALK positivity in neuroblastic tumors correlated with advanced tumor types
23777859 Ligand independent activation of anaplastic lymphoma kinase (ALK) results when the cytokine pleiotrophin (PTN) interacts with its receptor, the receptor protein tyrosine phosphatase beta-zeta (RPTPbeta-zeta). Review)
23774148 We have demonstrated that FISH testing for ALK can be performed simultaneously with other diagnostic procedures, providing oncologists with results in a timely manner to make informed decisions about patient treatment.
23769207 Use of crizotinib to treat patients with advanced, ALK-positive NSCLC.
23751074 The anaplastic lymphoma kinase (ALK) break points in acral/mucosal melanomas, were investigated.
23743932 Chromogenic in situ hybridization is a highly reliable, sensitive and specific method for the detection of ALK gene rearrangements in pulmonary adenocarcinomas.
23730215 Dual mutation of Tyr644 and Tyr664 in Nucleophosmin-anaplastic lymphoma kinase(NPM-ALK)abrogates its physical association with IGF-IR.
23729361 Functional ALK rearrangements were mutually exclusive with EGFR and KRAS mutations in a large Western patient population. This lack of overlap was also observed in ALK-positive cancers with acquired resistance to crizotinib
23716548 Non-common type anplastic lymphoma kinase-positive anaplastic large cell lymphomas express CD8 more frequently than common type.
23683537 Whose tumor had EGFR and ALK genetic aberration.
23669222 Data suggest that using circulating tumor cells (CTCs) harboring a unique ALK rearrangement and mesenchymal phenotype may arise from clonal selection of tumor cells.
23669200 ALK-break negative NSCLC cases revealed concordant homogeneous results by means of FISH.
23664446 The first report concerning the presence of the EML4-ALK fusion gene in a sarcomatoid carcinoma of the lung.
23664096 Results indicate rare overexpression of anaplastic lymphoma kinase (ALK) mRNA in 4% of cases of inflammatory breast cancer (IBC) and in 2% of non-IBC samples.
23661334 Profiling of 100 non-small cell lung cancers identified numerous genetic alterations impacting fibroblast growth factor receptor 3 (FGFR3) in lung squamous cell carcinoma and a novel ALK fusion partner in lung adenocarcinoma.
23639470 ALK gene rearrangment is associated with advanced non-small-cell lung cancer.
23625156 ALK rearrangement and EML4-ALK variation is associated with lung adenocarcinoma.
23617826 ALK rearrangement is associated with early pneumothorax as a feature of response to crizotinib therapy in lung adenocarcinoma.
23574788 the anaplastic lymphoma kinase protein was detected with high frequency in Merkel cell carcinomas
23568951 SCC4 treatment with demethylating agents induced ALK expression.
23561259 It is a promising candidate for a therapeutic target as well as for a diagnostic molecular marker in NSCLC.
23536384 ALK gene rearrangement is associated with lung adenocarcinoma.
23523007 Detection of ALK rearrangement using ICC on routine Papanicolau cytology slides is considered to be advantageous for lung cancer treatments.
23495083 ALK gene rearrangement is associated with metastatic lung adenocarcinoma.
23490651 Data indicate that anaplastic lymphoma kinase (ALK) translocations are not present in oesophageal cancer, ALK amplifications are common events with comparable rates in cell carcinoma (SCC) and adenocarcinoma (AC).
23486271 ALK rearrangement is associated with response to therapy in non-small-cell lung cancer.
23484153 Targeted resequencing reveals ALK fusions in non-small cell lung carcinomas detected by FISH, immunohistochemistry, and real-time RT-PCR: a comparison of four methods.
23453647 ALK translocations appear to be constant between primary tumors and BM, amplifications seem to be more prevalent in BM. ALK translocation, but not ALK amplification is associated with ALK protein overexpression.
23434628 The new multiplex deep sequencing method is capable to quickly detect resistance mutations within the ALK kinase domain from tumor biopsies.
23407559 ALK gene rearrangement is associated with non-small-cell lung cancer.
23407557 ALK protein overexpression and ALK gene rearrangement is associated with lung adenocarcinomas.
23401436 Anaplastic lymphoma kinase (ALK) gene rearrangements are present in a small subset of non-small-cell lung cancers. ALK-positive cancers are highly sensitive to small-molecule ALK kinase inhibitors, such as crizotinib.
23379755 The prevalence of ALK translocation in an unselected population of European patients with advanced non-small-cell lung carcinomas was 10%.
23360421 Patients showing high ALK and low Shf mRNA expressions showed poor prognosis.
23344087 ALK rearrangement is associated with crizotinib resistance in non-small-cell lung cancer.
23338972 Our investigation of the mechanisms underlying the decrease in miR-26a in this lymphoma revealed novel evidence that STAT3, a major downstream substrate of NPM-ALK tyrosine kinase activity, suppresses MIR26A1 gene expression.
23335077 MET and ALK may have roles in poor survival in Ewing sarcoma
23307059 Report subtype-specific incidence of ALK immunoreactivity in rhabdomyosarcomas and showed the association between ALK expression and several clinicopathologic/molecular parameters.
23291583 Case Report: fatal case of recurrent ALK-negative anaplastic large cell lymphoma presenting as ulcerating skin lesion.
23289484 Global genomic comparison with SNP arrays showed tumours with ALK fusion to have fewer alterations in oncogenes and suppressor genes despite a similar overall aberration frequency, suggesting strong oncogenic potency of ALK activation by gene fusion
23205942 The expression of ALK in mycosis fungoides, stage IA.
23154552 ALK gene rearrangement is associated with metastasis in non-small-cell lung cancer.
23139213 These results indicate that genomic rearrangements constitute an alternative mechanism to ALK point mutations resulting in receptor activation.
23104988 The identification and characterisation of two novel neuroblastoma ALK mutations, is reported.
23092569 A known mutation C3375A in ALK was successfully identified in children, and its incidence is not influenced by the clinical features of childhood neuroblastoma.
23084186 The results of the present study support the hypothesis that activated ALK tumors represent a specific subset of neuroblastomas
23070248 Anaplastic lymphoma kinase gene rearrangement is associated with Hepatoid carcinoma of the lung.
23064464 inhibition of PDGFRA and PDGFRB in a patient with refractory late-stage NPM-ALK+ Anaplastic large cell lymphoma resulted in rapid, complete and sustained remission
23050789 We found rearranged ALK in 10 of 19 radiation-exposed papillary thyroid cancer (PTC) cases, but none among 6 patients with PTC with no radiation exposure.
23020707 Discordance between anaplastic lymphoma kinase status occurred in primary non-small-cell lung cancers and their corresponding metastases.
22932897 Crystal structures of the ALK kinase domain containing the F1174L and R1275Q neuroblastoma mutation.
22895149 ALK rearrangement is associated with response to therapy in metastatic non-small-cell lung cancer.
22892933 the present study is the first in Latin America to present clinicopathologic information regarding ALK-rearranged NSCLC in patients from this geographic area.
22810114 ALK mutation may be responsible for medulloblastoma.
22781601 CD99 is highly expressed in anaplastic large-cell lymphoma, and showed high rate of co-expression with ALK.
22773605 In six pediatric cases of anaplastic large cell lymphoma the expression of anaplastic lymphoma kinase was confirmed.
22748945 Testing patients with advanced or metastatic NSCLC for EGFR mutation status may help doctors to determine those who are most likely to respond to EGFR TK inhibitors, tailoring therapy at diagnosis
22743654 In renal cell carcinoma ALK rearrangement and/or an increase in ALK copy number area associated with poorer prognosis.
22743652 Report histologic subtypes and distinctive cytomorphologic features of ALK-rearranged lung adenocarcinomas.
22736493 Lung neoplasm patients who harbor EML4-ALK fusion genes generally have wild type EGFR and KRAS genes.
22726922 Extra copies of ALK gene locus are a frequent genetic aberration in both ALK-positive and ALK-negative anaplastic large cell lymphomas and is a favorable prognostic marker for the patients.
22705117 ALK gene amplification is a nonrandom and clonally related event in a subset of pulmonary sarcomatoid carcinoma.
22646268 This is the first report, to our knowledge, of ALK gene rearrangements in inflammatory myofibroblastic tumors in the female genital tract.
22570254 immunohistochemical analysis of ovarian tumor tissue microarray detected aberrant ALK expression in 2% to 4% serous carcinoma patients
22569898 nonsmall cell lung cancers (NSCLC) harboring activating EGFR mutations were more likely to express low ERCC1 and thymidylate synthetase (TS) mRNA levels; patients with NSCLC who had ALK rearrangement were more likely to express low TS mRNA levels
22484425 Expression of MYCN or ALK(F1174L), one of the oncogenic ALK variants identified in primary neuroblastomas, enabled these cells to grow independently of c-MycER(T) activity in vitro and caused formation of neuroblastoma-like tumors.
22471704 review will discuss our current understanding of ALK in human cancer and the implication of recent results for treatment
22439933 Coexpression of activated ALK with MYCN provides prosurvival signals that block this apoptotic response and allow continued expansion and oncogenic transformation of hyperplastic neuroblasts, thus promoting progression to neuroblastoma.
22385925 NSCLC patients with leptomeningeal carcinomatosis (LM), treated with ALK inhibitor.
22334442 The fusion transcript of ALK and PTPN3 identified resulted from translocation of a part of ALK gene into the third intron of PTPN3. Analysis of the transcript sequence indicates that no protein with any enzymatic activity is produced.
22334013 ALK mutation is not associated with crizotinib resistance in Non-Small Cell Lung Cancer.
22327623 transforming ability of all of the ALK led to multiple transformed foci formation in culture and in subcutaneous tumors in a nude mouse tumorigenicity assay
22327622 identified at least one clinically relevant genomic alteration in 59% of the samples and revealed two gene fusions, C2orf44-ALK in a colorectal cancer sample and KIF5B-RET in a lung adenocarcinoma.
22317764 Data indicate that 266 (76.2%) tumors harbored EGFR mutations, 16 (4.6%) HER2 mutations, 15 (4.3%) EML4-ALK fusions, 7 (2.0%) KRAS mutations, and 2 (0.6%) BRAF mutations.
22286764 Both wild-type and gain-of-function mutants in ALK are able to stimulate transcription at the MYCN promoter.
22282022 in patients with nonsmall cell lung cancer, ALK gene rearrangement was significantly associated with pericardial disease and pleural disease; patients with ALK gene rearrangements and patients with EGFR mutations were predisposed to liver metastasis compared to triple negative cohort
22280150 rearrangement for ALK locus by fluorescence in situ hybridization was found in one lung and in two central nervous system samples of inflammatory myofibroblastic tumor
22249260 Our findings provide a novel insight into the mechanism of deregulation of the ALK kinase and its roles in neuroblastoma pathogenesis.
22203728 Data show that CEP-28122 is a highly potent and selective orally active anaplastic lymphoma kinase (ALK) inhibitor, and selective against ALK-positive human cancer cell growth.
22184391 ALK aberrations on genomic and protein levels are frequently found in RMSs. ALK may play a role in tumor biology.
22157554 An overview of the diagnostic assays available for detecting ALK rearrangement.
22135231 Data indicate that PIK3CA mutations occur in lung adenocarcinomas, usually concurrently with EGFR, KRAS, and anaplastic lymphoma kinase (ALK).
22134072 Our findings suggest that ALK positivity is associated with a significantly poor outcome in nonsmoking-related adenocarcinoma and that ALK-positive tumors may be associated with an increased risk of brain and liver metastases.
22129856 ALK rearrangement was not a significant prognostic factor in surgically resectable NSCLC.
22124476 Echinoderm microtubule-associated protein like 4-ALK fusion gene is associated with longer overall survival of lung adenocarcinoma patients with wild-type epidermal growth factor receptor mutations.
22086496 It was concluded that not all anaplastic lymphoma kinase mutants have neoplastic transformation potential and may represent ''passenger'' mutations in the evolution of cancer.
22085494 The frequency of ALK mutations in neuroblastoma is low and solitary copy number change of it is rarely observed.
22080568 findings are important because they provide a molecular basis of ALK-positive lung adenocarcinomas and triple-negative lung adenocarcinomas and further stratify more or less aggressive subgroups of triple-negative lung ADC
22071890 ALK deleterious mutations are rare events in neuroblastoma patients with a high probability of predisposition. Other predisposing genes remain to be discovered.
22071784 ALK gene rearrangement is associated with lung adenocarcinomas.
21989914 Results demonstrate that the extent and timing of sympathetic neurogenesis is controlled by Midkine and Alk signaling.
21972109 study reports a novel syndromic presentation associating congenital Neuroblastoma with severe encephalopathy nnd abnormal shape of the brainstem on brain MRI in two unrelated sporadic cases harboring de novo, germline, heterozygous ALK gene mutations
21940108 We detected the ALK mutation (F1174C and R1275Q) in 2 (3.7%) of the 54 neuroblastoma specimens examined
21933749 In patients with advanced, ALK-positive non-small cell lung cancer, crizotinib therapy is associated with improved survival.
21855164 ALK rearrangement is strongly associated with ALK immunoreactivity, and was seen only in lung tumours with pure signet-ring morphology and solid growth pattern.
21847362 novel ALK point mutations possessed tumorigenic effects mainly through hyperphosphorylation of Y1604 and activation of downstream oncogenic signaling.
21847065 ALK translocation is associated with non-small cell lung cancer.
21799923 Alk plays an evolutionary conserved role in ethanol-related behaviors
21784300 We found no genome-wide statistically significant associations but identified several plausible candidate genes among findings at p < 5E-05:ALK, TMEM132D, LRRC7, SEMA3A, and STIP1.
21765024 NPM-ALK induces expression of the growth-promoting receptor ICOS.
21757253 The powerful effect of ALK inhibitor on EML4-ALK NSCLC was observed.
21753699 Report comprehensive histologic analysis of ALK-rearranged lung carcinomas.
21734404 Finding suggests that variants in the non-mutated ALK gene or another gene linked to it may affect penetrance of the ALK mutations and risk of developing NB in familial cases.
21720997 ALK gene rearrangement is associated with nonsmall cell lung cancer.
21656749 The discovery of the novel KIF5B-ALK variant further consolidated the role of aberrant anaplastic lymphoma kinase signaling in lung carcinogenesis.
21642865 Anaplastic lymphoma kinase translocation is associated with pemetrexed efficacy in non-small cell lung cancer.
21632861 high levels of mutated and wild-type ALK mediate similar molecular functions that may contribute to a malignant phenotype in primary neuroblastoma.
21625996 Neuroblastoma cell lines often express ALK at high levels.
21596819 Results reveal two novel gain-of-function mutations of ALK in certain anaplastic thyroid cancers.
21587085 ALK gene rearrangement is associated with non-small cell lung cancer.
21575866 Identify CH5424802, as a potent, selective, and orally available ALK inhibitor with a unique chemical scaffold, showing preferential antitumor activity against cancers with gene alterations of ALK.
21518927 p16INK4a/pRb may function as an alternative pathway of oncogene-induced senescence; the reactivation of p16INK4a expression might be a novel strategy to restore the senescence program in some tumors.
21488949 Case Report: document gastroduodenal involvement of ALK-positive anaplastic large cell lymphoma.
21474455 Studies indicate that the best characterized alterations of ALK associated with cancer are gene rearrangements.
21471522 MiR-29a down-regulation in ALK-positive anaplastic large cell lymphomas contributes to apoptosis blockade through MCL-1 overexpression.
21430068 Novel ALK fusions are being identified in various tumors in addition to inflammatory myofibroblastic tumor.
21420271 New molecular targets are on investigation, such as EML4-ALK translocation.
21358343 High ALK is associated with poor tumor responses to EGFR tyrosine kinase inhibitors in pulmonary adenocarcinoma.
21356191 EML4-ALK fusion variants have a role in non-small cell lung cancer
21336183 ALK gene rearrangement is associated with response to pemetrexed therapy in patients with non-small cell lung cancer.
21288922 Studies indicate ALK as a therapeutic target in patients with ALK-rearranged NSCLC.
21278610 ALK gene rearrangement is associated with non-small cell lung carcinoma.
21258247 ALK gene rearrangement is associated with non-small cell lung carcinoma.
21233844 selective targeting of the Mdk/ALK axis could help to improve the efficacy of antitumoral therapies for gliomas.
21233286 Data show that anaplastic lymphoma kinase (ALK)-comtaining granules are novel mRNA-containing cytoplasmic foci that could protect translatable mRNAs from degradation, contributing to ALK-mediated oncogenicity.
21205076 brief overview of the role of ALK mutations in neuroblastoma pathogenesis and their implication in future therapeutics [review]
21164297 Describe an aggressive intra-abdominal variant of inflammatory myofibroblastic tumor with nuclear membrane or perinuclear ALK staining.
21129606 EML4-ALK fusion gene mutations are widely recognized alterations involved in biology and the clinical management of lung adenocarcinoma.This review reports the molecular bases that have led clinical application of detection for such genetic impairments.
21107285 Increased ALK gene copy number and amplification are frequent in non-small cell lung cancer.
21076462 The data identify the kidney as a new organ site for ALK-associated carcinomas and VCL as a novel ALK fusion partner.
21070126 Observational study of gene-disease association. (HuGE Navigator)
21045017 Serine phosphorylation of NPM-ALK, contributes to its oncogenic potential.
21036415 frequent rearrangement in lung signet-ring cell carcinoma
21030459 Reports the identification of a secondary mutation in ALK, F1174L, as one cause of crizotinib resistance in a patient with an inflammatory myofibroblastic tumor harboring a RANBP2-ALK translocation who progressed while on crizotinib therapy.
20970119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20957039 demonstrated that PHOX2B drives ALK gene transcription by directly binding its promoter, which therefore represents a novel PHOX2B target
20934803 Studies indicate that ALK has been found to be rearranged, mutated, or amplified in a series of tumours.
20805506 Five members of the miR-17-92 cluster were expressed more highly in anaplastic lymphoma kinase (ALK)(+) anaplastic large-cell lymphoma (ALCL), whereas miR-155 was expressed more than 10-fold higher in ALK(-) ALCL.
20731666 Studies indicate that ALK is mutated in 6-9% of sporadic cases, and is either amplified or constitutively activated through mutations.
20719933 Studies indicate that ALK mutations occur in equal frequencies across all genomic subtypes, but F1174L mutants are observed in a higher frequency of MYCN-amplified tumors and show increased transforming capacity as compared with the R1275Q mutants.
20719933 Observational study of gene-disease association. (HuGE Navigator)
20695522 ALK-KD-PHA-E429 structure led to the identification of a potential regulatory mechanism involving a link made between a short helical segment immediately following the DFG motif and an N-terminal two-stranded beta-sheet.
20632993 Data show that the ALK crystal structure helps explain the reported unique peptide substrate specificity and the importance of phosphorylation of the first A-loop Tyr1278 for kinase activity.
20624322 EML4-ALK fusion appears to be tightly associated with ALK mRNA expression levels. RACE-coupled PCR sequencing is a highly sensitive method that could be used clinically for the identification of EML4-ALK-positive patients
20624322 Observational study of gene-disease association. (HuGE Navigator)
20621063 zinc alone rapidly activates ALK.
20554525 active NPM-ALK, but not a kinase-dead mutant, bound and induced Grb2 phosphorylation in tyrosine 160
20451371 The anaplastic lymphoma kinase gene has similarity to the insulin receptor subfamily of kinases and is emerging as having increased pathologic and potential therapeutic importance in malignant disease.
20428197 RanBP2/ALK rearrangement are associated with atypical myeloproliferative leukemia.
20424160 Results support the notion that the tumor suppressor effects of SHP1 on NPM-ALK are dependent on its ability to bind to this oncogenic protein.
20393185 Data show that the TNF/Fas/TRAIL pathway is modulated by nucleophosmin-anaplastic lymphoma kinase in anaplastic large cell lymphoma.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20185586 ALK autoantibody titers in anaplastic lymphoma kinase positive anaplastic large cell lymphoma inversely correlated with stage and amount of circulating tumor cells.
20169312 Describe a case of ALK-positive primary systemic anaplastic large cell lymphoma with a long clinical course and extensive cutaneous manifestations.
20101209 Studies indicate that understanding of familial and syndromic neuroblastoma recently has made considerable progress with the identification of PHOX2B and ALK as NB susceptibility genes.
20009909 ALK gene rearrangements are associated with non-small cell lung cancer.
19887368 The kinase activation loop in NPM-ALK regulates its tyrosine phosphorylation pattern.
19834503 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19737969 The presence of an EML-ALK rearrangement was verified by identifying genomic fusion points in tumor samples representative of breast, colon, and NSCLC.
19723661 ALK protein expression was significantly up-regulated in advanced/metastatic compared with localized neuroblastomas; overexpression of either mutated or wild-type ALK defines poor prognosis neuroblastoma patients
19717436 T-cell lymphomas characterized by the expression of anaplastic lymphoma kinase (ALK+ TCL) fail to express the TNFalpha and frequently display DNA methylation of the TNFalpha gene promoter.
19671850 Lung adenocarcinomas with ALK rearrangements are uncommon in the western population and represent a distinct entity of carcinomas with unique characteristics.
19667264 Data show that compared with the EGFR mutant and WT/WT cohorts, patients with EML4-ALK mutant tumors were significantly younger and were more likely to be men.
19667264 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19656550 copy number aberrations of the ALK gene is a frequent genetic event in the development of neuroblastomas
19656549 ALK expression was not found in any of our cases of intracranial inflammatory pseudotumors
19636007 Anaplastic lymphoma kinase-positive diffuse large B-cell lymphoma: a rare clinicopathologic entity with poor prognosis.
19589272 This retrospective study evaluated 15 cases of inflammatory myofibroblastic tumours (IMTs) to determine histological atypicality, clinicopathological features, outcomes, and expression of anaplastic lymphoma kinase-1 (ALK1) and p53.
19535344 NPM-ALK kinase has a role in the regulation of responsiveness of tumor cells with cdk dysregulation
19531656 The NPM/ALK alteration affects diverse cellular pathways, and provide novel insights into NPM/ALK-positive anaplastic large cell lymphoma pathobiology.
19506219 Observational study of gene-disease association. (HuGE Navigator)
19459784 Reports have have highlighted ALK as a significant player and target for drug development in cancer.
19455469 HIV-1 Nef and ALK show similar effects by increasing different cytokines/chemokines, such as IL-1beta, TNF-alpha, and RANTES, that may be relevant for HAD pathogenesis
19423729 identified novel reciprocal functional interactions between IGF-IR and NPM-ALK
19386350 Anaplastic lymphoma kinase immunoreactivity in non-small cell lung carcinomas was associated with transcriptional up-regulation, ALK locus rearrangement, and the presence of EML4-ALK fusion transcript.
19305144 The expression of the dual specificity phosphatase CDC25A, is deregulated in Ba/F3 cells expressing the oncogenic protein NPM/ALK and in human cell lines derived from NPM/ALK-positive anaplastic large cell lymphomas.
19286999 ALK signaling leads to the functional inactivation and/or degradation of p53 in JNK and MDM2 dependent manners.
19250532 ALK-DLBCL is a distinct variant of DLBCL with plasmacytic differentiation, which is characterized by a bimodal age incidence curve, primarily nodal involvement, plasmablastic morphology, aggressive behavior and poor response to standard therapies.
19176054 Phosphorylation of AKT and mTOR is correlated with anaplastic lymphoma kinase expression in anaplastic large cell lymphoma.
19147828 The EML4-ALK transcript cannot be regarded as a specific diagnostic tool for non-small cell lung cancer.
19135051 This study demonstrates expression of both ALK protein and ALK mRNA are positively correlated with expression of ALK-associated fusion transcripts.
19131589 these data highlight the functional diversity of NPM-ALK and provide new research directions for the study of the biology of this oncoprotein.
19074885 Observational study of gene-disease association. (HuGE Navigator)
18990089 ALK protein contributes to NB(neuroblastoma) oncogenesis providing a highly interesting putative therapeutic target in a subset of unfavourable NB tumours.
18974134 concomitant inhibition of Cdc42 and NPM-ALK kinase acted synergistically to induce apoptosis of ALCL cells
18923525 detection of previously unknown mutations in the ALK gene, which encodes a receptor tyrosine kinase, in 8% of primary neuroblastomas
18923524 the anaplastic lymphoma kinase, originally identified as a fusion kinase in a subtype of non-Hodgkin's lymphoma (NPM-ALK) and more recently in adenocarcinoma of lung (EML4-ALK), is also a frequent target of genetic alteration in advanced neuroblastoma
18923523 data identify ALK as a critical player in neuroblastoma development that may hence represent a very attractive therapeutic target in this disease that is still frequently fatal with current treatments
18845790 ATIC associated with nucleophosmin-ALK, and its phosphorylation required ALK activity. ALK-mediated ATIC phosphorylation enhanced its enzymatic activity.
18788887 there is ALK overexpression in rhabdomyosarcomas, most likely independent of fusion status
18724359 results demonstrate that heritable mutations of ALK are the main cause of familial neuroblastoma, and that germline or acquired activation of this cell-surface kinase is a tractable therapeutic target for this lethal paediatric malignancy
18677384 Complex abnormalities of ALK gene exist in systemic anaplastic large cell lymphoma cases, and different types of ALK gene might lead to different clinical outcome.
18660380 the spectrum of diseases exhibiting ALK translocation should be expanded to include ALK(+) histiocytosis
18615104 high prevalence of anti-ALK antibodies in pediatric ALK-positive ALCL and relationship between minimal residual disease and anti-ALK antibody response
18594010 EML4-ALK fusion gene is expressed in lung cancer
18593892 A lung cancer cell line expressing endogenous variant 3 of EML4-ALK underwent cell death on exposure to a specific inhibitor of ALK catalytic activity.
18549625 There is a high incidence of ALK expression in anaplastic large cell lymphoma.
18458503 Fluorescence in situ hybridization and molecular studies on the bone marrow aspirate specimens led to the detection of a clathrin (CLTC)/ALK rearrangement.
18451166 A subset of lung cancers, lymphomas, and neuroblastomas that harbor genomic ALK alterations may be clinically responsive to pharmacologic ALK inhibition.
18414414 EML4-ALK fusion transcript is not present in gastrointestinal or breast cancers and is specific to NSCLC.
18320074 EML4-ALK fusions occur in less than 3% of non-small cell lung cancers samples; EML4 and/or ALK amplifications also occur.
18242762 EML4-ALK fusion gene product is involved in the carcinogenesis in non-small cell lung carcinomas
18220322 different types of cytogenetic aberrations may involve the ALK gene in ALK-positive diffuse large B-cell lymphoma leading to peculiar immunohistochemical staining patterns [case reports]
18166835 ALK is part of a fusion protein linked to histological characteristics in a subset of lung neoplasms.
18165268 besides MYCN and ALK, other genes proximal and distal to MYCN are highly expressed in neuroblastoma
18097461 Translocations or deregulated expression of ALK contribute to oncogenesis and genetic or pharmacological tools, aimed at neutralizing its activity in anaplastic lymphoma [REVIEW]
18070884 findings indicate that phosphorylation of the first tyrosine of the YXXXYY motif is necessary for the autoactivation of the ALK kinase domain and the transforming activity of nucleoplasmin/ALK
17998938 Fusion protein nucleophosmin (NPM)-ALK activates GTPase Rac1 via phosphatidylkinase 3-kinase (PI3K) and protein-tyrosine kinase c-src (Src) in anaplastic large cell lymphoma patients.
17922009 Oncogenic NPM1-ALK contains the ALK catalytic domain plus NPM1 oligomerization motif and mediates malignant cell transformation by epigenetic silencing of signal transducer and activator of transcription STAT5A in T-cell anaplastic large cell lymphomas.
17904822 Pleiotrophin failed to activate anaplastic lymphoma kinase (ALK) in neuroblastoma/glioblastoma cells expressing this receptor. ALK is still an orphan receptor in vertebrates.
17690253 JunB is a critical target of mTOR and is translationally regulated in NPM-ALK-positive lymphomas.
17681947 phosphorylation of ALK in PTN-stimulated cells is mediated through the PTN/RPTPbeta/zeta signaling pathway
17537995 identify splicing factor as a novel nucleophosmin 1/anaplastic lymphoma kinase-binding protein and substrate
17490616 This study thus supports the possibility that activated ALK may be important in human breast cancers and potentially activated either through the PTN/RPTPbeta/zeta signaling pathway.
17274988 A functional role for Shc and likely FRS2 in ALK-dependant MAP-kinase activation and neuronal differentiation of PC12 cells.
17077326 molecular signature of ALK- anaplastic large-cell lymphoma included overexpression of CCR7, CNTFR, IL22, and IL21 genes
17071493 CD26 and cell surface adenosine deaminase are selectively expressed on ALK-positive, but not on ALK-negative, anaplastic large cell lymphoma and Hodgkin's lymphoma
16880530 ALK has a proapoptotic activity in the absence of ligand, whereas it is antiapoptotic in the presence of its ligand and when the kinase is intrinsically activated.
16878150 recruitment of insulin receptor substrate-1 to activated ALK and the activation of NF-kappaB are essential for the autocrine growth and survival signaling of midkine
16835382 AUF1 was phosphorylated by ALK in vitro and was hyperphosphorylated in NPM-ALK-expressing cells.
16825495 Loss of SHP1 enhances JAK3/STAT3 signaling and decreases proteosome degradation of JAK3 and NPM-ALK in ALK+ anaplastic large-cell lymphoma.
16766651 NPM/ALK-carrying T cell lymphoma (ALK+TCL) cells secrete IL-10 and TGF-beta and express FoxP3, indicating their T regulatory (Treg) cell phenotype.
16709933 constitutive expression of C/EBPbeta in ALK-positive anaplastic large cell lymphoma and its relationship to NPM-ALK
16651537 can be adapted for the identification of known and unknown translocation partners of chimeric ALK fusion proteins involved in oncogenesis
16623783 Pseudosarcomatous myofibroblastic proliferations of the genitourinary tract may show ALK immunopositivity but do not show consistent ALK rearrangement by fluorescent in situ hybridization.
16604305 Observational study of gene-disease association. (HuGE Navigator)
16254137 Potent and selective ALK inhibitors may have therapeutic application for anaplastic lymphoma kinase.
16161041 Genomic PCR and subsequent sequencing showed that the breakpoints were located in intron 23 of SEC31-like 1 protein-transport protein and intron 20 of ALK
16153455 We conclude that Jak3 activation is predominantly restricted to ALK-positive ALCL tumors.
15933425 CONCLUSIONS: ALK-ALCL arising in the skin represents a single disease with a broad spectrum of morphology; clinicians and pathologists should be aware of this neutrophil-rich (NR) variant with aggressive clinical presentation.
15928040 ALK-mediated alphaDGK activation is dependent on p60src tyrosine kinase, with which alphaDGK forms a complex; alphaDGK activation is involved in the control of ALK-mediated mitogenic properties.
15886198 analysis of differentiation of PC12 cells and human embryonic kidney 293 cells transfected with ALK shows absence of agonist activity of pleiotrophin
15713979 Although 9 of 36 patients with cutaneous CD30(+) lymphoproliferative diseases had progression of their disease, neither mutations of the p53 gene nor ALK immunoreactivity were found in any of these biopsies.
15583856 ALK has roles in oncogenesis of haematopoietic and non-haematopoietic tumors [review]
15226403 ALK receptor tyrosine kinase has roles promoting cell growth and neurite outgrowth
15161657 STAT3 directly contributes to the high level of TIMP1 expression in anaplastic lymphoma kinase-positive anaplastic large cell lymphoma.
15004538 High dose therapy and stem cell transplantation does not produce long-term disease free survival in patients with recurrent chemotherapy-sensitive ALK-negative large cell lymphoma.
14962911 FOXO3a is a barrier to hematopoietic transformation that is overcome by phosphorylation and cytoplasmic relocalization induced by the expression of NPM-ALK
14656879 results show a pivotal role for Bcl-XL in ALK-mediated oncogenicity
14563642 Src-kinases, particularly pp60(c-src), associate with and are activated by NPM-ALK expression in various cells, and in cell lines established from patients with large cell lymphoma
12800156 In a case of anaplastic large cell lymphoma, ALK is fused to a portion of non-muscle myosin heavy chain gene, MYH9, localized 6 bp downstream of MSN-ALK in the same exonic sequence, resulting in an in-frame fusion of the two partner proteins.
12763927 novel fusion created by the ALK gene on chromosome 2p23 and NPM on 5q35 or other variant translocation partners in a rare variant of diffuse large B-cell lymphoma
12213716 co-expression of c-Myc and ALK was seen in tumor cells of ALK-positive anaplastic large cell lymphomas; C-Myc may be a downstream target of ALK signaling
12185581 ALK-ShcC signal activation, possibly caused by co-amplification with the N-myc gene, might give additional effects on malignant tumor progression of neuroblastoma.ShcC is a potent substrate of the activated ALK kinase.
12122009 midkine binds to ALK and has a role in signal transduction for cell growth and survival
12115586 results do not support any involvement of ALK in the stimulation of tumorigenic cell growth or differentiation
12112524 Novel fusion partners CARS and KIAA1618 (ALO17) have been detected with variant rearrangements of ALK in anaplastic large-cell lymphoma and inflammatory myofibroblastic tumor cases.
12036886 ALK-positive anaplastic large cell lymphoma had significantly higher levels of caspase 3, while high expression of the antiapoptotic proteins Bcl-2 and PI9 was almost completely restricted to ALK-negative cases.
11877285 ALK as a novel lymphoma-associated tumor antigen: identification of 2 HLA-A2.1-restricted CD8+ T-cell epitopes.
11809760 Pleiotrophin signaling through anaplastic lymphoma kinase is rate-limiting for glioblastoma growth

AA Sequence

MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARD      1 - 70
LLLPPSSSELKAGRPEARGSLALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSVRKLRRAKQ     71 - 140
LVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQGEGRLRIRLMPEKKASEVGREGRLSAAIRA    141 - 210
SQPRLLFQIFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPL    211 - 280
HDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVS    281 - 350
VHRHLQPSGRYIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFF    351 - 420
ALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYCNFEDGFCGWT    421 - 490
QGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFPAPIKSSPCELRMSWLIRGVL    491 - 560
RGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPLLDVSDRFWLQMVAWWGQGSRAIVAFDNISI    561 - 630
SLDCYLTISGEDKILQNTAPKSRNLFERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQ    631 - 700
CNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDM    701 - 770
LYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLII    771 - 840
AAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAM    841 - 910
KKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVN    911 - 980
IKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVL    981 - 1050
AFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIR   1051 - 1120
GLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSL   1121 - 1190
PRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCP   1191 - 1260
GPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPY   1261 - 1330
PSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE   1331 - 1400
YGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPA   1401 - 1470
VEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCT   1471 - 1540
VPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILK   1541 - 1610
SKNSMNQPGP                                                               1611 - 1620
//

Text Mined References (449)

PMID Year Title
26966027 2016 First-in-human, open-label dose-escalation and dose-expansion study of the safety, pharmacokinetics, and antitumor effects of an oral ALK inhibitor ASP3026 in patients with advanced solid tumors.
26951079 2016 Second- and third-generation ALK inhibitors for non-small cell lung cancer.
26857243 2016 Clinical utility of TERT promoter mutations and ALK rearrangement in thyroid cancer patients with a high prevalence of the BRAF V600E mutation.
26825369 2016 Improving Selection Criteria for ALK Inhibitor Therapy in Non-Small Cell Lung Cancer: A Pooled-Data Analysis on Diagnostic Operating Characteristics of Immunohistochemistry.
26823889 2015 Epithelioid inflammatory myofibroblastic sarcoma treated with ALK inhibitor: a case report and review of literature.
26755435 2016 Molecular mechanisms that underpin EML4-ALK driven cancers and their response to targeted drugs.
26719536 2016 Non-Small Cell Lung Cancer Cells Acquire Resistance to the ALK Inhibitor Alectinib by Activating Alternative Receptor Tyrosine Kinases.
26687816 2016 Mutation-Independent Activation of the Anaplastic Lymphoma Kinase in Neuroblastoma.
26630010 2015 Augmentor ? and ? (FAM150) are ligands of the receptor tyrosine kinases ALK and LTK: Hierarchy and specificity of ligand-receptor interactions.
26618223 2016 An update of ALK inhibitors in human clinical trials.
26581482 2015 Focused molecular analysis of small cell lung cancer: feasibility in routine clinical practice.
26568289 2015 Discovery of Inhibitors That Overcome the G1202R Anaplastic Lymphoma Kinase Resistance Mutation.
26555338 2015 Chronic Obstructive Pulmonary Disease-Related Non-Small-Cell Lung Cancer Exhibits a Low Prevalence of EGFR and ALK Driver Mutations.
26544515 2016 Rearranged EML4-ALK fusion transcripts sequester in circulating blood platelets and enable blood-based crizotinib response monitoring in non-small-cell lung cancer.
26537995 2016 Targeted therapies for treatment of non-small cell lung cancer--Recent advances and future perspectives.
26517679 2015 Targeting stemness is an effective strategy to control EML4-ALK+ non-small cell lung cancer cells.
26505450 2015 Clinical characteristics of patients with non-small cell lung cancers harboring anaplastic lymphoma kinase rearrangements and primary lung adenocarcinoma harboring epidermal growth factor receptor mutations.
26444240 2015 Alternative transcription initiation leads to expression of a novel ALK isoform in cancer.
26422230 2015 Intratumor Heterogeneity of ALK-Rearrangements and Homogeneity of EGFR-Mutations in Mixed Lung Adenocarcinoma.
26418745 2015 FAM150A and FAM150B are activating ligands for anaplastic lymphoma kinase.
26416997 2015 Intratumoral Heterogeneity of ALK-Rearranged and ALK/EGFR Coaltered Lung Adenocarcinoma.
26384210 2015 ALK alteration is a frequent event in aggressive breast cancers.
26379151 2016 Morphologic Features of ALK-negative Anaplastic Large Cell Lymphomas With DUSP22 Rearrangements.
26338968 2015 Targeting autophagy enhances the anti-tumoral action of crizotinib in ALK-positive anaplastic large cell lymphoma.
26314227 2016 Cystic Brain Metastases Occurring in Anaplastic Lymphoma Kinase Gene Rearranged Non-Small-Cell Lung Cancer Patients Receiving Crizotinib.
26299615 2015 New therapeutic strategies in neuroblastoma: combined targeting of a novel tyrosine kinase inhibitor and liposomal siRNAs against ALK.
26295973 2015 Identification of Driving ALK Fusion Genes and Genomic Landscape of Medullary Thyroid Cancer.
26276782 2015 Polypoid laryngeal inflammatory myofibroblastic tumors: misleading lesions: description of six cases showing ALK overexpression.
26223379 2015 Progress in the identification of subgroups in ALK-negative anaplastic large-cell lymphoma.
26172300 2015 Detection of novel and potentially actionable anaplastic lymphoma kinase (ALK) rearrangement in colorectal adenocarcinoma by immunohistochemistry screening.
26152804 2015 ALK and ROS1 rearrangements tested by fluorescence in situ hybridization in cytological smears from advanced non-small cell lung cancer patients.
26147305 2015 Understanding the Interplay between Expression, Mutation and Activity of ALK Receptor in Rhabdomyosarcoma Cells for Clinical Application of Small-Molecule Inhibitors.
26121314 2015 Gene fusion detection in formalin-fixed paraffin-embedded benign fibrous histiocytomas using fluorescence in situ hybridization and RNA sequencing.
26067621 2015 DNA methylation fingerprint of neuroblastoma reveals new biological and clinical insights.
26059187 2015 Deep Sequencing Reveals Occurrence of Subclonal ALK Mutations in Neuroblastoma at Diagnosis.
26045865 2015 Different histopathology but the same clonality: ALK rearrangement in a patient with metastatic non-small-cell lung cancer.
26032424 2015 Therapeutically Targetable ALK Mutations in Leukemia.
26019170 2015 Induction of PD-L1 Expression by the EML4-ALK Oncoprotein and Downstream Signaling Pathways in Non-Small Cell Lung Cancer.
25975837 2015 ALK-negative anaplastic large cell lymphoma is sensitive to bortezomib through Noxa upregulation and release of Bax from Bcl-2.
25967762 2015 Anaplastic Lymphoma Kinase Immunocytochemistry on Cell-Transferred Cytologic Smears of Lung Adenocarcinoma.
25966792 2015 Efficacy and tolerability of crizotinib in the treatment of ALK-positive, advanced non-small cell lung cancer in Chinese patients.
25964588 2015 Rare Complex Mutational Profile in an ALK Inhibitor-resistant Non-small Cell Lung Cancer.
25929957 2015 French multicentric validation of ALK rearrangement diagnostic in 547 lung adenocarcinomas.
25857825 2015 ALK rearrangement and overexpression in epithelioid fibrous histiocytoma.
25855381 2015 Development of lung adenocarcinomas with exclusive dependence on oncogene fusions.
25813404 2015 Novel ALK fusion partners in lung cancer.
25813151 2015 The clinicopathological significance of ALK rearrangements and KRAS and EGFR mutations in primary pulmonary mucinous adenocarcinoma.
25803816 2015 Anaplastic lymphoma kinase gene copy number gain in inflammatory breast cancer (IBC): prevalence, clinicopathologic features and prognostic implication.
25795305 2015 Fusion genes with ALK as recurrent partner in ependymoma-like gliomas: a new brain tumor entity?
25789835 2015 A novel, highly sensitive ALK antibody 1A4 facilitates effective screening for ALK rearrangements in lung adenocarcinomas by standard immunohistochemistry.
25789833 2015 Comparison of methods in the detection of ALK and ROS1 rearrangements in lung cancer.
25740311 2015 Microtubule association of EML proteins and the EML4-ALK variant 3 oncoprotein require an N-terminal trimerization domain.
25736571 2015 I1171 missense mutation (particularly I1171N) is a common resistance mutation in ALK-positive NSCLC patients who have progressive disease while on alectinib and is sensitive to ceritinib.
25735977 2015 EML4-ALK induces epithelial-mesenchymal transition consistent with cancer stem cell properties in H1299 non-small cell lung cancer cells.
25727400 2015 Activity of second-generation ALK inhibitors against crizotinib-resistant mutants in an NPM-ALK model compared to EML4-ALK.
25723109 2015 Molecular characterization of inflammatory myofibroblastic tumors with frequent ALK and ROS1 gene fusions and rare novel RET rearrangement.
25714698 2015 A Pan-Cancer Review of ALK Mutations: Implications for Carcinogenesis and Therapy.
25708242 2015 Anaplastic lymphoma kinase translocation is correlated with anaplastic lymphoma kinase expression and mutually exclusive with epidermal growth factor receptor mutation in Taiwanese non-small cell lung cancer.
25706305 2015 Clinicopathological characteristics of patients with non-small-cell lung cancer who harbor EML4-ALK fusion gene: a meta-analysis.
25683346 2015 Anaplastic lymphoma kinase protein expression, genetic abnormalities, and phosphorylation in soft tissue tumors: Phosphorylation is associated with recurrent metastasis.
25682942 2015 FN1: a novel fusion partner of ALK in an inflammatory myofibroblastic tumor.
25682925 2015 Brain metastases in patients with EGFR-mutated or ALK-rearranged non-small-cell lung cancers.
25674293 2014 ALK-positive anaplastic large cell lymphoma with an unusual alveolar growth pattern.
25652313 2015 NeuroD1 promotes neuroblastoma cell growth by inducing the expression of ALK.
25605972 2015 Heparin is an activating ligand of the orphan receptor tyrosine kinase ALK.
25602801 2015 Clinical, histopathologic, and genomic features of Spitz tumors with ALK fusions.
25596129 2015 Oncogenic TPM3-ALK activation requires dimerization through the coiled-coil structure of TPM3.
25577516 2015 Comparative analysis of clinicoradiologic characteristics of lung adenocarcinomas with ALK rearrangements or EGFR mutations.
25576649 2015 Automation of ALK gene rearrangement testing with fluorescence in situ hybridization (FISH): a feasibility study.
25575117 2015 Advanced adenocarcinoma of the lung: comparison of CT characteristics of patients with anaplastic lymphoma kinase gene rearrangement and those with epidermal growth factor receptor mutation.
25557162 2015 Cytomorphological features of ALK-positive lung adenocarcinomas: psammoma bodies and signet ring cells.
25529354 2015 Detection of ALK rearrangements in malignant pleural effusion cell blocks from patients with advanced non-small cell lung cancer: a comparison of Ventana immunohistochemistry and fluorescence in situ hybridization.
25527865 2014 Detection of ALK protein expression in lung squamous cell carcinomas by immunohistochemistry.
25527510 2015 Standard immunohistochemistry efficiently screens for anaplastic lymphoma kinase rearrangements in differentiated thyroid cancer.
25517749 2014 ALK mutations confer differential oncogenic activation and sensitivity to ALK inhibition therapy in neuroblastoma.
25514802 2015 ALK testing in lung adenocarcinoma: technical aspects to improve FISH evaluation in daily practice.
25501013 2015 A detailed clinicopathologic study of ALK-translocated papillary thyroid carcinoma.
25434695 2014 A large-scale cross-sectional study of ALK rearrangements and EGFR mutations in non-small-cell lung cancer in Chinese Han population.
25421750 2015 Treatment Efficacy and Resistance Mechanisms Using the Second-Generation ALK Inhibitor AP26113 in Human NPM-ALK-Positive Anaplastic Large Cell Lymphoma.
25413595 2015 Epithelioid cell histiocytoma of the skin with clonal ALK gene rearrangement resulting in VCL-ALK and SQSTM1-ALK gene fusions.
25393796 2014 Identification of a novel HIP1-ALK fusion variant in Non-Small-Cell Lung Cancer (NSCLC) and discovery of ALK I1171 (I1171N/S) mutations in two ALK-rearranged NSCLC patients with resistance to Alectinib.
25393795 2014 Assessment of ALK status by FISH on 1000 Spanish non-small cell lung cancer patients.
25351247 2014 The kinase ALK stimulates the kinase ERK5 to promote the expression of the oncogene MYCN in neuroblastoma.
25312988 2014 Are there imaging characteristics associated with lung adenocarcinomas harboring ALK rearrangements?
25270523 2015 Presence of anaplastic lymphoma kinase translocation in sarcomatoid carcinoma of head and neck and treatment effect of crizotinib: A case series.
25228590 2014 Molecular rationale for the use of PI3K/AKT/mTOR pathway inhibitors in combination with crizotinib in ALK-mutated neuroblastoma.
25228534 2014 Two novel ALK mutations mediate acquired resistance to the next-generation ALK inhibitor alectinib.
25193384 2014 ALK-dependent control of hypoxia-inducible factors mediates tumor growth and metastasis.
25145835 2014 The oncogenic JUNB/CD30 axis contributes to cell cycle deregulation in ALK+ anaplastic large cell lymphoma.
25144242 2014 A novel mechanism of EML4-ALK rearrangement mediated by chromothripsis in a patient-derived cell line.
25083769 2014 Identification of ALK gene alterations in urothelial carcinoma.
25071110 2014 Emergence of new ALK mutations at relapse of neuroblastoma.
25028527 2014 A rare case of an EML4-ALK-rearranged lung adenocarcinoma missed by in situ-hybridization but detected by RT-PCR.
25017418 2014 ALK expression is absent in pancreatic ductal adenocarcinoma.
24982409 2014 Non-small cell lung cancer patients with EML4-ALK fusion gene are insensitive to cytotoxic chemotherapy.
24952482 2014 Receptor ligand-triggered resistance to alectinib and its circumvention by Hsp90 inhibition in EML4-ALK lung cancer cells.
24952065 2014 Exploring the structural and functional impact of the ALK F1174L mutation using bioinformatics approach.
24947326 2014 Wild-type ALK and activating ALK-R1275Q and ALK-F1174L mutations upregulate Myc and initiate tumor formation in murine neural crest progenitor cells.
24942490 2014 ALK fusion and its association with other driver gene mutations in Finnish non-small cell lung cancer patients.
24935562 2014 Serum carcinoembryonic antigen levels before initial treatment are associated with EGFR mutations and EML4- ALK fusion gene in lung adenocarcinoma patients.
24899136 2015 Imaging Characteristics in ALK Fusion-Positive Lung Adenocarcinomas by Using HRCT.
24894770 2014 ALK-negative anaplastic large cell lymphoma is a genetically heterogeneous disease with widely disparate clinical outcomes.
24888607 2014 Simultaneous diagnostic platform of genotyping EGFR, KRAS, and ALK in 510 Korean patients with non-small-cell lung cancer highlights significantly higher ALK rearrangement rate in advanced stage.
24885982 2014 ALK molecular phenotype in non-small cell lung cancer: CT radiogenomic characterization.
24885886 2014 Epidermal growth factor receptor mutations and anaplastic lymphoma kinase rearrangements in lung cancer with nodular ground-glass opacity.
24885803 2014 ALK rearrangement in a large series of consecutive non-small cell lung cancers: comparison between a new immunohistochemical approach and fluorescence in situ hybridization for the screening of patients eligible for crizotinib treatment.
24878018 2014 Immunohistochemistry, fluorescence in situ hybridization, and reverse transcription-polymerase chain reaction for the detection of anaplastic lymphoma kinase gene rearrangements in patients with non-small cell lung cancer: potential advantages and methodologic pitfalls.
24846683 2016 Detection of ALK rearrangement in an octogenarian patient with pleomorphic carcinoma of the lung.
24830726 2014 Flotillin-1 regulates oncogenic signaling in neuroblastoma cells by regulating ALK membrane association.
24815447 2014 Retrospective study of ALK rearrangement and clinicopathological implications in completely resected non- small cell lung cancer patients in Northern Thailand: role of screening with D5F3 antibodies.
24785465 2015 Discovery of novel 2,4-diarylaminopyrimidine analogues (DAAPalogues) showing potent inhibitory activities against both wild-type and mutant ALK kinases.
24778081 2014 Status of Anaplastic Lymphoma Kinase (ALK) in malignant mesothelioma.
24775606 2014 Immunohistochemical screening and fluorescence in situ hybridization confirmation of ALK translocation in lung adenocarcinoma and its clinicopathological significance: a single-center large-scale investigation of Chinese patients.
24750504 2014 ALK gene aberrations and the JUN/JUNB/PDGFR axis in metastatic NSCLC.
24736082 2014 A novel fusion of TPR and ALK in lung adenocarcinoma.
24736079 2014 Next-generation sequencing reveals a Novel NSCLC ALK F1174V mutation and confirms ALK G1202R mutation confers high-level resistance to alectinib (CH5424802/RO5424802) in ALK-rearranged NSCLC patients who progressed on crizotinib.
24736067 2014 ALK status testing in non-small-cell lung carcinoma by FISH on ThinPrep slides with cytology material.
24722154 2014 High MET receptor expression but not gene amplification in ALK 2p23 rearrangement positive non-small-cell lung cancer.
24706829 2014 Crystal structure of EML1 reveals the basis for Hsp90 dependence of oncogenic EML4-ALK by disruption of an atypical ?-propeller domain.
24698967 2014 Clinical and pathologic findings of Spitz nevi and atypical Spitz tumors with ALK fusions.
24698962 2014 VCL-ALK renal cell carcinoma in children with sickle-cell trait: the eighth sickle-cell nephropathy?
24691006 2014 Gain of ALK gene copy number may predict lack of benefit from anti-EGFR treatment in patients with advanced colorectal cancer and RAS-RAF-PI3KCA wild-type status.
24687827 2015 Remarkable Response to Crizotinib in Woman With Anaplastic Lymphoma Kinase-Rearranged Anaplastic Thyroid Carcinoma.
24648382 2014 Anaplastic lymphoma kinase gene rearrangements in cytological samples of non-small cell lung cancer: comparison with histological assessment.
24633422 2014 Whole-genome sequencing of an aggressive BRAF wild-type papillary thyroid cancer identified EML4-ALK translocation as a therapeutic target.
24629636 2014 ALK, ROS1 and RET fusions in 1139 lung adenocarcinomas: a comprehensive study of common and fusion pattern-specific clinicopathologic, histologic and cytologic features.
24613930 2014 Identification of the transforming STRN-ALK fusion as a potential therapeutic target in the aggressive forms of thyroid cancer.
24613277 RANBP2-ALK fusion combined with monosomy 7 in acute myelomonocytic leukemia.
24518095 2014 Atypical negative ALK break-apart FISH harboring a crizotinib-responsive ALK rearrangement in non-small-cell lung cancer.
24518086 2014 Parallel FISH and immunohistochemical studies of ALK status in 3244 non-small-cell lung cancers reveal major discordances.
24509625 2014 Activating mutations in ALK kinase domain confer resistance to structurally unrelated ALK inhibitors in NPM-ALK-positive anaplastic large-cell lymphoma.
24495999 2014 Detection of rearrangements and transcriptional up-regulation of ALK in FFPE lung cancer specimens using a novel, sensitive, quantitative reverse transcription polymerase chain reaction assay.
24478382 2014 Patterns of ALK expression in different human cancer types.
24475247 2014 Identification of a recurrent STRN/ALK fusion in thyroid carcinomas.
24470379 2014 Identification of RANBP2-ALK fusion in ALK positive diffuse large B-cell lymphoma.
24462463 2014 Clinical and prognostic implications of ALK and ROS1 rearrangements in never-smokers with surgically resected lung adenocarcinoma.
24443522 2014 Lung cancers with concomitant EGFR mutations and ALK rearrangements: diverse responses to EGFR-TKI and crizotinib in relation to diverse receptors phosphorylation.
24442099 2014 Clinicopathologic characteristics of ALK rearrangements in primary lung adenocarcinoma with identified EGFR and KRAS status.
24419423 2014 Identification and characterization of ALK kinase splicing isoforms in non-small-cell lung cancer.
24419060 2014 The selective anaplastic lymphoma receptor tyrosine kinase inhibitor ASP3026 induces tumor regression and prolongs survival in non-small cell lung cancer model mice.
24415871 2014 ALK gene copy number gain and its clinical significance in hepatocellular carcinoma.
24403104 2014 Anaplastic lymphoma kinase gene rearrangements in patients with advanced-stage non-small-cell lung cancer: CT characteristics and response to chemotherapy.
24389447 2013 Effective crizotinib schedule for brain metastases in ALK rearrangement metastatic non-small-cell lung cancer.
24389446 2013 Choroidal metastases responsive to crizotinib therapy in a lung adenocarcinoma patient with ALK 2p23 fusion identified by ALK immunohistochemistry.
24389444 2013 Lung adenocarcinoma patient refractory to gefitinib and responsive to crizotinib, with concurrent rare mutation of the epidermal growth factor receptor (L861Q) and increased ALK/MET/ROS1 gene copy number.
24389440 2013 The central nervous system as a sanctuary site in ALK-positive non-small-cell lung cancer.
24388371 2014 Effective enrichment strategy for EML4-ALK fusion gene screening in patients with non-small cell lung cancer.
24356251 2013 ALK is a MYCN target gene and regulates cell migration and invasion in neuroblastoma.
24346098 2014 Preselection based on clinical characteristics in German non-small-cell lung cancer patients screened for EML4-ALK translocation.
24300132 2014 Clinical characteristics associated with ALK rearrangements in never-smokers with pulmonary adenocarcinoma.
24293609 2014 Chromogenic in situ hybridisation (CISH) is a powerful method to detect ALK-positive non-small cell lung carcinomas.
24288180 2013 Crizotinib: a review of its use in the treatment of anaplastic lymphoma kinase-positive, advanced non-small cell lung cancer.
24277751 2014 Pulmonary inflammatory myofibroblastic tumor harboring EML4-ALK fusion gene.
24276038 2014 Metachronous neuroblastoma in an infant with germline translocation resulting in partial trisomy 2p: a role for ALK?
24228132 2013 Anaplastic lymphoma kinase-positive large B-cell lymphoma: a case report with emphasis on the cytological features of the pleural effusion.
24218456 2013 Malignant transformation of CD4+ T lymphocytes mediated by oncogenic kinase NPM/ALK recapitulates IL-2-induced cell signaling and gene expression reprogramming.
24200637 Low frequency KRAS mutations in colorectal cancer patients and the presence of multiple mutations in oncogenic drivers in non-small cell lung cancer patients.
24192124 2013 EGFR and KRAS mutations, and ALK fusions: current developments and personalized therapies for patients with advanced non-small-cell lung cancer.
24149177 2013 High ALK mRNA expression has a negative prognostic significance in rhabdomyosarcoma.
24129244 2013 ALK gene amplification is associated with poor prognosis in colorectal carcinoma.
24060861 2013 Mechanistic insight into ALK receptor tyrosine kinase in human cancer biology.
23991058 2013 Breakpoint features of genomic rearrangements in neuroblastoma with unbalanced translocations and chromothripsis.
23988776 2014 EGFR, KRAS, BRAF and ALK gene alterations in lung adenocarcinomas: patient outcome, interplay with morphology and immunophenotype.
23975180 2014 STAT3-mediated activation of microRNA cluster 17~92 promotes proliferation and survival of ALK-positive anaplastic large cell lymphoma.
23951022 2013 Comparison of IHC, FISH and RT-PCR methods for detection of ALK rearrangements in 312 non-small cell lung cancer patients in Taiwan.
23932486 2013 Smoking status and self-reported race affect the frequency of clinically relevant oncogenic alterations in non-small-cell lung cancers at a United States-based academic medical practice.
23922677 2013 ALK-rearranged lung cancer in Chinese: a comprehensive assessment of clinicopathology, IHC, FISH and RT-PCR.
23922356 2014 Prognostic implications of anaplastic lymphoma kinase gene aberrations in rhabdomyosarcoma; an immunohistochemical and fluorescence in situ hybridisation study.
23919423 2013 Analysis of EGFR, EML4-ALK, KRAS, and c-MET mutations in Chinese lung adenocarcinoma patients.
23887300 2014 EGFR alterations and EML4-ALK rearrangement in primary adenocarcinoma of the urinary bladder.
23867124 2013 Simultaneous targeting of insulin-like growth factor-1 receptor and anaplastic lymphoma kinase in embryonal and alveolar rhabdomyosarcoma: a rational choice.
23851431 2013 Rare ALK expression but no ALK rearrangement in pancreatic ductal adenocarcinoma and neuroendocrine tumors.
23814019 2013 Integrated phosphoproteomic and metabolomic profiling reveals NPM-ALK-mediated phosphorylation of PKM2 and metabolic reprogramming in anaplastic large cell lymphoma.
23797004 2013 ALK amplification and protein expression predict inferior prognosis in neuroblastomas.
23777859 2013 Anaplastic lymphoma kinase: "Ligand Independent Activation" mediated by the PTN/RPTP?/? signaling pathway.
23774148 2013 Experience in integrating ALK testing and crizotinib into the routine treatment of patients with non-small cell lung cancer.
23769207 2013 Treatment and detection of ALK-rearranged NSCLC.
23751074 2013 Identification of anaplastic lymphoma kinase break points and oncogenic mutation profiles in acral/mucosal melanomas.
23743932 2013 Chromogenic in situ hybridization is a reliable assay for detection of ALK rearrangements in adenocarcinomas of the lung.
23730215 2013 Molecular and functional characterizations of the association and interactions between nucleophosmin-anaplastic lymphoma kinase and type I insulin-like growth factor receptor.
23729361 2013 ALK rearrangements are mutually exclusive with mutations in EGFR or KRAS: an analysis of 1,683 patients with non-small cell lung cancer.
23716548 2013 Expression of CD8 is associated with non-common type morphology and outcome in pediatric anaplastic lymphoma kinase-positive anaplastic large cell lymphoma.
23683537 2013 Coexistence of EGFR mutation and ALK translocation in NSCLC: literature review and case report of response to gefitinib.
23669222 2013 Detection of circulating tumor cells harboring a unique ALK rearrangement in ALK-positive non-small-cell lung cancer.
23669200 2013 Anaplastic lymphoma kinase (ALK) gene rearrangement in non-small cell lung cancer (NSCLC): results of a multi-centre ALK-testing.
23664446 2013 EML4-ALK translocation in both metachronous second primary lung sarcomatoid carcinoma and lung adenocarcinoma: a case report.
23664096 2013 Rare overexpression of anaplastic lymphoma kinase gene in inflammatory and non-inflammatory breast cancer.
23661334 2013 Identification of recurrent FGFR3 fusion genes in lung cancer through kinome-centred RNA sequencing.
23639470 2013 CH5424802 (RO5424802) for patients with ALK-rearranged advanced non-small-cell lung cancer (AF-001JP study): a single-arm, open-label, phase 1-2 study.
23625156 2013 Detection of ALK rearrangement by immunohistochemistry in lung adenocarcinoma and the identification of a novel EML4-ALK variant.
23617826 2013 Early pneumothorax as a feature of response to crizotinib therapy in a patient with ALK rearranged lung adenocarcinoma.
23574788 2013 Expression of anaplastic lymphoma kinase in Merkel cell carcinomas.
23568951 2013 Epigenetic deregulation of the anaplastic lymphoma kinase gene modulates mesenchymal characteristics of oral squamous cell carcinomas.
23561259 2013 Crizotinib administered via nasogastric and percutaneous endoscopic gastrostomy tubes for the successful treatment of ALK-rearranged lung cancer in a patient with poor performance status.
23536384 2013 The use of stained cytologic direct smears for ALK gene rearrangement analysis of lung adenocarcinoma.
23523007 2013 Clinical application of immunocytochemical detection of ALK rearrangement on cytology slides for detection or screening of lung adenocarcinoma.
23495083 2013 Identification of EGFR mutation, KRAS mutation, and ALK gene rearrangement in cytological specimens of primary and metastatic lung adenocarcinoma.
23490651 2013 Amplification but not translocation of anaplastic lymphoma kinase is a frequent event in oesophageal cancer.
23486271 2013 Rapid response of brain metastasis to crizotinib in a patient with ALK rearrangement-positive non-small-cell lung cancer.
23484153 2013 Targeted resequencing reveals ALK fusions in non-small cell lung carcinomas detected by FISH, immunohistochemistry, and real-time RT-PCR: a comparison of four methods.
23453647 2013 ALK gene translocations and amplifications in brain metastases of non-small cell lung cancer.
23434628 2013 Multiplexed deep sequencing analysis of ALK kinase domain identifies resistance mutations in relapsed patients following crizotinib treatment.
23407559 2013 Recommendations for the analysis of ALK gene rearrangements in non-small-cell lung cancer: a consensus of the Italian Association of Medical Oncology and the Italian Society of Pathology and Cytopathology.
23407557 2013 Combined use of ALK immunohistochemistry and FISH for optimal detection of ALK-rearranged lung adenocarcinomas.
23401436 2013 ALK in lung cancer: past, present, and future.
23382219 2013 Structural basis for endosomal trafficking of diverse transmembrane cargos by PX-FERM proteins.
23379755 2013 The ALK translocation in advanced non-small-cell lung carcinomas: preapproval testing experience at a single cancer centre.
23360421 2013 Novel adaptor protein Shf interacts with ALK receptor and negatively regulates its downstream signals in neuroblastoma.
23344087 2013 Heterogeneity of genetic changes associated with acquired crizotinib resistance in ALK-rearranged lung cancer.
23338972 2013 NPM-ALK up-regulates iNOS expression through a STAT3/microRNA-26a-dependent mechanism.
23335077 2013 Expression and clinical relevance of MET and ALK in Ewing sarcomas.
23307059 2013 Anaplastic lymphoma kinase status in rhabdomyosarcomas.
23291583 2013 Recurrent ALK-negative anaplastic large T-cell lymphoma presenting as necrotizing vasculitis.
23289484 2013 Allelotypes of lung adenocarcinomas featuring ALK fusion demonstrate fewer onco- and suppressor gene changes.
23205942 2013 The expression of ALK in mycosis fungoides, stage IA.
23154552 2012 Local ablative therapy of oligoprogressive disease prolongs disease control by tyrosine kinase inhibitors in oncogene-addicted non-small-cell lung cancer.
23139213 2013 Characterization of rearrangements involving the ALK gene reveals a novel truncated form associated with tumor aggressiveness in neuroblastoma.
23104988 2013 Cell culture and Drosophila model systems define three classes of anaplastic lymphoma kinase mutations in neuroblastoma.
23092569 2012 [ALK gene mutations in childhood neuroblastoma].
23084186 2012 Clinical feature of anaplastic lymphoma kinase-mutated neuroblastoma.
23070248 2012 Hepatoid carcinoma of the lung with anaplastic lymphoma kinase gene rearrangement.
23064464 2012 PDGFR blockade is a rational and effective therapy for NPM-ALK-driven lymphomas.
23050789 2012 Rearranged anaplastic lymphoma kinase (ALK) gene in adult-onset papillary thyroid cancer amongst atomic bomb survivors.
23020707 2013 Discordance between anaplastic lymphoma kinase status in primary non-small-cell lung cancers and their corresponding metastases.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22932897 2012 The R1275Q neuroblastoma mutant and certain ATP-competitive inhibitors stabilize alternative activation loop conformations of anaplastic lymphoma kinase.
22895149 2012 Next-generation sequencing identifies and immunohistochemistry confirms a novel crizotinib-sensitive ALK rearrangement in a patient with metastatic non-small-cell lung cancer.
22892933 2012 Anaplastic lymphoma kinase gene rearrangement in non-small-cell lung cancer in a Brazilian population.
22810114 2012 Identification of ALK germline mutation (3605delG) in pediatric anaplastic medulloblastoma.
22781601 2012 [Co-expression of CD99/MIC2 and ALK in anaplastic large-cell lymphoma tissues and its significance].
22773605 2013 ALK-positive anaplastic large cell lymphoma limited to the skin: clinical, histopathological and molecular analysis of 6 pediatric cases. A report from the ALCL99 study.
22748945 Personalizing medicine: strategies for implementing the evaluation of anaplastic lymphoma kinase rearrangement in non-small-cell lung cancer in Portugal.
22743654 2012 ALK alterations in adult renal cell carcinoma: frequency, clinicopathologic features and outcome in a large series of consecutively treated patients.
22743652 2012 Histologic and cytomorphologic features of ALK-rearranged lung adenocarcinomas.
22736493 2012 Detection of EML4-ALK fusion genes in non-small cell lung cancer patients with clinical features associated with EGFR mutations.
22726922 2012 Extra copies of ALK gene locus is a recurrent genetic aberration and favorable prognostic factor in both ALK-positive and ALK-negative anaplastic large cell lymphomas.
22705117 2012 Multiparametric molecular characterization of pulmonary sarcomatoid carcinoma reveals a nonrandom amplification of anaplastic lymphoma kinase (ALK) gene.
22646268 2012 ALK-1 protein expression and ALK gene rearrangements aid in the diagnosis of inflammatory myofibroblastic tumors of the female genital tract.
22570254 2012 Identification of anaplastic lymphoma kinase as a potential therapeutic target in ovarian cancer.
22569898 2012 Association of EGFR mutation or ALK rearrangement with expression of DNA repair and synthesis genes in never-smoker women with pulmonary adenocarcinoma.
22484425 2013 MYCN and ALKF1174L are sufficient to drive neuroblastoma development from neural crest progenitor cells.
22471704 2012 Anaplastic lymphoma kinase in human cancer.
22439933 2012 Activated ALK collaborates with MYCN in neuroblastoma pathogenesis.
22385925 2012 ALK inhibitor crizotinib combined with intrathecal methotrexate treatment for non-small cell lung cancer with leptomeningeal carcinomatosis.
22334442 2012 Discovery of ALK-PTPN3 gene fusion from human non-small cell lung carcinoma cell line using next generation RNA sequencing.
22334013 2012 Acquired resistance to the ALK inhibitor crizotinib in the absence of an ALK mutation.
22327623 2012 RET, ROS1 and ALK fusions in lung cancer.
22327622 2012 Identification of new ALK and RET gene fusions from colorectal and lung cancer biopsies.
22317764 2012 Frequency of driver mutations in lung adenocarcinoma from female never-smokers varies with histologic subtypes and age at diagnosis.
22286764 2012 Anaplastic Lymphoma Kinase (ALK) regulates initiation of transcription of MYCN in neuroblastoma cells.
22282022 2012 Oncogene status predicts patterns of metastatic spread in treatment-naive nonsmall cell lung cancer.
22280150 Inflammatory myofibroblastic tumor of the lung in children: anaplastic lymphoma kinase (ALK) expression and clinico-pathological correlation.
22249260 2012 Aberrant activation of ALK kinase by a novel truncated form ALK protein in neuroblastoma.
22203728 2012 CEP-28122, a highly potent and selective orally active inhibitor of anaplastic lymphoma kinase with antitumor activity in experimental models of human cancers.
22184391 2012 Anaplastic lymphoma kinase aberrations in rhabdomyosarcoma: clinical and prognostic implications.
22157554 2011 Crizotinib and testing for ALK.
22135231 2012 Coexistence of PIK3CA and other oncogene mutations in lung adenocarcinoma-rationale for comprehensive mutation profiling.
22134072 2012 Worse disease-free survival in never-smokers with ALK+ lung adenocarcinoma.
22129856 2012 Clinicopathologic implication of ALK rearrangement in surgically resected lung cancer: a proposal of diagnostic algorithm for ALK-rearranged adenocarcinoma.
22124476 2012 EML4-ALK translocation predicts better outcome in lung adenocarcinoma patients with wild-type EGFR.
22086496 2013 Assessment of the transforming potential of novel anaplastic lymphoma kinase point mutants.
22085494 2012 Copy number status and mutation analyses of anaplastic lymphoma kinase (ALK) gene in 90 sporadic neuroblastoma tumors.
22080568 2012 Identification of genes upregulated in ALK-positive and EGFR/KRAS/ALK-negative lung adenocarcinomas.
22071890 2012 ALK germline mutations in patients with neuroblastoma: a rare and weakly penetrant syndrome.
22071784 2012 Dual IHC and FISH testing for ALK gene rearrangement in lung adenocarcinomas in a routine practice: a French study.
21989914 2011 Midkine and Alk signaling in sympathetic neuron proliferation and neuroblastoma predisposition.
21972109 2011 Germline gain-of-function mutations of ALK disrupt central nervous system development.
21940108 2011 Oncogenic anaplastic lymphoma kinase (ALK) mutation in neuroblastomas and other pediatric tumors.
21933749 2011 Effect of crizotinib on overall survival in patients with advanced non-small-cell lung cancer harbouring ALK gene rearrangement: a retrospective analysis.
21855164 2012 ALK translocation is associated with ALK immunoreactivity and extensive signet-ring morphology in primary lung adenocarcinoma.
21847362 2011 Identification of oncogenic point mutations and hyperphosphorylation of anaplastic lymphoma kinase in lung cancer.
21847065 2011 ALK translocation in non-small cell lung cancer with adenocarcinoma and squamous cell carcinoma markers.
21799923 2011 An evolutionary conserved role for anaplastic lymphoma kinase in behavioral responses to ethanol.
21784300 2011 Genome-wide association study of the child behavior checklist dysregulation profile.
21765024 2011 Oncogenic tyrosine kinase NPM-ALK induces expression of the growth-promoting receptor ICOS.
21757253 2012 ALK fusion gene positive lung cancer and 3 cases treated with an inhibitor for ALK kinase activity.
21753699 2011 Comprehensive histologic analysis of ALK-rearranged lung carcinomas.
21734404 2011 Genome-wide linkage analysis to identify genetic modifiers of ALK mutation penetrance in familial neuroblastoma.
21720997 2012 Distinct clinical features and outcomes in never-smokers with nonsmall cell lung cancer who harbor EGFR or KRAS mutations or ALK rearrangement.
21656749 2011 A novel KIF5B-ALK variant in nonsmall cell lung cancer.
21642865 2011 Anaplastic lymphoma kinase translocation: a predictive biomarker of pemetrexed in patients with non-small cell lung cancer.
21632861 2011 High ALK receptor tyrosine kinase expression supersedes ALK mutation as a determining factor of an unfavorable phenotype in primary neuroblastoma.
21625996 2011 Anaplastic lymphoma kinase (ALK) inhibitor response in neuroblastoma is highly correlated with ALK mutation status, ALK mRNA and protein levels.
21596819 2011 Anaplastic thyroid cancers harbor novel oncogenic mutations of the ALK gene.
21587085 2011 Detection of ALK gene rearrangement in non-small cell lung cancer: a comparison of fluorescence in situ hybridization and chromogenic in situ hybridization with correlation of ALK protein expression.
21575866 2011 CH5424802, a selective ALK inhibitor capable of blocking the resistant gatekeeper mutant.
21518927 2011 The lymphoma-associated NPM-ALK oncogene elicits a p16INK4a/pRb-dependent tumor-suppressive pathway.
21488949 2011 Education and Imaging: Gastrointestinal: gastroduodenal involvement of ALK-positive anaplastic large cell lymphoma.
21474455 2011 Targeting oncogenic ALK: a promising strategy for cancer treatment.
21471522 2011 MiR-29a down-regulation in ALK-positive anaplastic large cell lymphomas contributes to apoptosis blockade through MCL-1 overexpression.
21430068 2011 Pulmonary inflammatory myofibroblastic tumor expressing a novel fusion, PPFIBP1-ALK: reappraisal of anti-ALK immunohistochemistry as a tool for novel ALK fusion identification.
21420271 2011 [Lung cancer in never smoker: Epidemiology, molecular profiles and treatment].
21358343 2011 Clinicopathologic characteristics and outcomes of patients with anaplastic lymphoma kinase-positive advanced pulmonary adenocarcinoma: suggestion for an effective screening strategy for these tumors.
21356191 2011 Exon scanning by reverse transcriptase-polymerase chain reaction for detection of known and novel EML4-ALK fusion variants in non-small cell lung cancer.
21336183 2011 Anaplastic lymphoma kinase gene rearrangements in non-small cell lung cancer are associated with prolonged progression-free survival on pemetrexed.
21288922 2011 Targeting anaplastic lymphoma kinase in lung cancer.
21278610 2011 Correlation of IHC and FISH for ALK gene rearrangement in non-small cell lung carcinoma: IHC score algorithm for FISH.
21258247 2011 Screening of anaplastic lymphoma kinase rearrangement by immunohistochemistry in non-small cell lung cancer: correlation with fluorescence in situ hybridization.
21242967 2011 The constitutive activity of the ALK mutated at positions F1174 or R1275 impairs receptor trafficking.
21233844 2011 Stimulation of the midkine/ALK axis renders glioma cells resistant to cannabinoid antitumoral action.
21233286 2011 Novel mRNA-containing cytoplasmic granules in ALK-transformed cells.
21205076 2011 Oncogenic mutations of ALK in neuroblastoma.
21164297 2011 Epithelioid inflammatory myofibroblastic sarcoma: An aggressive intra-abdominal variant of inflammatory myofibroblastic tumor with nuclear membrane or perinuclear ALK.
21129606 2010 Driver mutations and differential sensitivity to targeted therapies: a new approach to the treatment of lung adenocarcinoma.
21107285 2011 Increased ALK gene copy number and amplification are frequent in non-small cell lung cancer.
21076462 2011 Renal cell carcinoma with novel VCL-ALK fusion: new representative of ALK-associated tumor spectrum.
21070126 2010 A novel BMPR2 gene mutation associated with exercise-induced pulmonary hypertension in septal defects.
21045017 2011 Serine phosphorylation of NPM-ALK, which is dependent on the auto-activation of the kinase activation loop, contributes to its oncogenic potential.
21036415 2011 Frequent ALK rearrangement and TTF-1/p63 co-expression in lung adenocarcinoma with signet-ring cell component.
21030459 2010 The neuroblastoma-associated F1174L ALK mutation causes resistance to an ALK kinase inhibitor in ALK-translocated cancers.
20970119 2011 Convergent animal and human evidence suggests a role of PPM1A gene in response to antidepressants.
20957039 2010 PHOX2B-mediated regulation of ALK expression: in vitro identification of a functional relationship between two genes involved in neuroblastoma.
20934803 2010 Anaplastic Lymphoma Kinase: role in specific tumours, and development of small molecule inhibitors for cancer therapy.
20805506 2010 Identification of differential and functionally active miRNAs in both anaplastic lymphoma kinase (ALK)+ and ALK- anaplastic large-cell lymphoma.
20731666 2010 Global genomic and RNA profiles for novel risk stratification of neuroblastoma.
20719933 2010 Meta-analysis of neuroblastomas reveals a skewed ALK mutation spectrum in tumors with MYCN amplification.
20695522 2010 Crystal structures of anaplastic lymphoma kinase in complex with ATP competitive inhibitors.
20632993 2010 Crystal structure of the ALK (anaplastic lymphoma kinase) catalytic domain.
20624322 2010 Fusion of EML4 and ALK is associated with development of lung adenocarcinomas lacking EGFR and KRAS mutations and is correlated with ALK expression.
20621063 2010 Activation of the orphan receptor tyrosine kinase ALK by zinc.
20554525 2010 Involvement of Grb2 adaptor protein in nucleophosmin-anaplastic lymphoma kinase (NPM-ALK)-mediated signaling and anaplastic large cell lymphoma growth.
20454865 2010 Structural basis for the recognition of nucleophosmin-anaplastic lymphoma kinase oncoprotein by the phosphotyrosine binding domain of Suc1-associated neurotrophic factor-induced tyrosine-phosphorylated target-2.
20451371 2010 The emerging pathogenic and therapeutic importance of the anaplastic lymphoma kinase gene.
20428197 2010 ALK fusion genes in children with atypical myeloproliferative leukemia.
20424160 2010 The tyrosine 343 residue of nucleophosmin (NPM)-anaplastic lymphoma kinase (ALK) is important for its interaction with SHP1, a cytoplasmic tyrosine phosphatase with tumor suppressor functions.
20393185 2010 Studies of phosphoproteomic changes induced by nucleophosmin-anaplastic lymphoma kinase (ALK) highlight deregulation of tumor necrosis factor (TNF)/Fas/TNF-related apoptosis-induced ligand signaling pathway in ALK-positive anaplastic large cell lymphoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20185586 2010 Correlation of the autoantibody response to the ALK oncoantigen in pediatric anaplastic lymphoma kinase-positive anaplastic large cell lymphoma with tumor dissemination and relapse risk.
20169312 2010 ALK-positive primary systemic anaplastic large cell lymphoma with extensive cutaneous manifestation.
20101209 2010 Molecular pathogenesis of peripheral neuroblastic tumors.
20009909 2009 ALK gene rearrangements: a new therapeutic target in a molecularly defined subset of non-small cell lung cancer.
19887368 2010 Functional characterization of the kinase activation loop in nucleophosmin (NPM)-anaplastic lymphoma kinase (ALK) using tandem affinity purification and liquid chromatography-mass spectrometry.
19834503 2009 Replication of CD58 and CLEC16A as genome-wide significant risk genes for multiple sclerosis.
19737969 2009 Exon array profiling detects EML4-ALK fusion in breast, colorectal, and non-small cell lung cancers.
19723661 2009 Mutation-independent anaplastic lymphoma kinase overexpression in poor prognosis neuroblastoma patients.
19717436 2009 Lack of TNFalpha expression protects anaplastic lymphoma kinase-positive T-cell lymphoma (ALK+ TCL) cells from apoptosis.
19671850 2009 Unique clinicopathologic features characterize ALK-rearranged lung adenocarcinoma in the western population.
19667264 2009 Clinical features and outcome of patients with non-small-cell lung cancer who harbor EML4-ALK.
19656550 2009 Aberrant copy numbers of ALK gene is a frequent genetic alteration in neuroblastomas.
19656549 2009 Inflammatory pseudotumors of the central nervous system.
19636007 2009 Anaplastic lymphoma kinase-positive diffuse large B-cell lymphoma: a rare clinicopathologic entity with poor prognosis.
19589272 Comparison of the clinical and immunohistochemical features, including anaplastic lymphoma kinase (ALK) and p53, in inflammatory myofibroblastic tumours.
19535344 2009 The effect of the cyclin-dependent kinase inhibitor flavopiridol on anaplastic large cell lymphoma cells and relationship with NPM-ALK kinase expression and activity.
19531656 2009 The proteomic signature of NPM/ALK reveals deregulation of multiple cellular pathways.
19506219 2009 Risk alleles for multiple sclerosis in multiplex families.
19459784 2009 Anaplastic lymphoma kinase: signalling in development and disease.
19423729 2009 IGF-IR tyrosine kinase interacts with NPM-ALK oncogene to induce survival of T-cell ALK+ anaplastic large-cell lymphoma cells.
19386350 2009 Anaplastic lymphoma kinase immunoreactivity correlates with ALK gene rearrangement and transcriptional up-regulation in non-small cell lung carcinomas.
19383809 2009 KIF5B-ALK, a novel fusion oncokinase identified by an immunohistochemistry-based diagnostic system for ALK-positive lung cancer.
19305144 2009 Upregulation of the CDC25A phosphatase down-stream of the NPM/ALK oncogene participates to anaplastic large cell lymphoma enhanced proliferation.
19286999 2009 NPM-ALK inhibits the p53 tumor suppressor pathway in an MDM2 and JNK-dependent manner.
19250532 2009 ALK-positive diffuse large B-cell lymphoma: report of four cases and review of the literature.
19176054 2008 [Study on activation of AKT/mTOR pathway in anaplastic large cell lymphoma].
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
19147828 2009 EML4-ALK rearrangement in non-small cell lung cancer and non-tumor lung tissues.
19135051 2009 Expression of ALK protein, mRNA and fusion transcripts in anaplastic large cell lymphoma.
19131589 2009 Proteome-wide identification of novel binding partners to the oncogenic fusion gene protein, NPM-ALK, using tandem affinity purification and mass spectrometry.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18990089 2008 High incidence of DNA mutations and gene amplifications of the ALK gene in advanced sporadic neuroblastoma tumours.
18974134 2008 The anaplastic lymphoma kinase controls cell shape and growth of anaplastic large cell lymphoma through Cdc42 activation.
18927303 2008 Multiplex reverse transcription-PCR screening for EML4-ALK fusion transcripts.
18923525 2008 Activating mutations in ALK provide a therapeutic target in neuroblastoma.
18923524 2008 Oncogenic mutations of ALK kinase in neuroblastoma.
18923523 2008 Somatic and germline activating mutations of the ALK kinase receptor in neuroblastoma.
18845790 2009 The enzymatic activity of 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase is enhanced by NPM-ALK: new insights in ALK-mediated pathogenesis and the treatment of ALCL.
18788887 ALK expression in rhabdomyosarcomas: correlation with histologic subtype and fusion status.
18724359 2008 Identification of ALK as a major familial neuroblastoma predisposition gene.
18677384 2008 [Anaplastic lymphoma kinase gene abnormality and the expression of its fusion protein in primary systemic anaplastic large cell lymphoma].
18660380 2008 ALK+ histiocytosis: a novel type of systemic histiocytic proliferative disorder of early infancy.
18615104 2009 Kinetics of humoral response to ALK and its relationship with minimal residual disease in pediatric ALCL.
18594010 2008 EML4-ALK fusion gene and efficacy of an ALK kinase inhibitor in lung cancer.
18593892 2008 Identification of novel isoforms of the EML4-ALK transforming gene in non-small cell lung cancer.
18549625 2008 [Expression of ALK protein in large cell lymphoma with ALCL chromosome translocation in relation to prognosis].
18458503 2008 [Cytomorphology and molecular characterization of CLTC-ALK rearrangement in 2 cases of ALK-positive diffuse large B-cell lymphoma with extensive bone marrow involvement].
18451166 2008 Genomic alterations of anaplastic lymphoma kinase may sensitize tumors to anaplastic lymphoma kinase inhibitors.
18414414 2008 EML4-ALK fusion transcript is not found in gastrointestinal and breast cancers.
18320074 2008 EML4-ALK fusion lung cancer: a rare acquired event.
18242762 2008 EML4-ALK fusion transcripts, but no NPM-, TPM3-, CLTC-, ATIC-, or TFG-ALK fusion transcripts, in non-small cell lung carcinomas.
18220322 2008 ALK-positive diffuse large B-cell lymphoma: report of three cases.
18166835 2008 EML4-ALK fusion is linked to histological characteristics in a subset of lung cancers.
18165268 2008 Genes proximal and distal to MYCN are highly expressed in human neuroblastoma as visualized by comparative expressed sequence hybridization.
18097461 2008 The anaplastic lymphoma kinase in the pathogenesis of cancer.
18083107 2007 Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.
18070884 2008 Characterization of some molecular mechanisms governing autoactivation of the catalytic domain of the anaplastic lymphoma kinase.
17998938 2008 Activation of Rac1 and the exchange factor Vav3 are involved in NPM-ALK signaling in anaplastic large cell lymphomas.
17922009 2007 STAT5A is epigenetically silenced by the tyrosine kinase NPM1-ALK and acts as a tumor suppressor by reciprocally inhibiting NPM1-ALK expression.
17904822 2007 In contrast to agonist monoclonal antibodies, both C-terminal truncated form and full length form of Pleiotrophin failed to activate vertebrate ALK (anaplastic lymphoma kinase)?
17690253 2007 The oncoprotein NPM-ALK of anaplastic large-cell lymphoma induces JUNB transcription via ERK1/2 and JunB translation via mTOR signaling.
17681947 2007 Anaplastic lymphoma kinase is activated through the pleiotrophin/receptor protein-tyrosine phosphatase beta/zeta signaling pathway: an alternative mechanism of receptor tyrosine kinase activation.
17537995 2007 NPM/ALK binds and phosphorylates the RNA/DNA-binding protein PSF in anaplastic large-cell lymphoma.
17490616 2007 Anaplastic lymphoma kinase is expressed in different subtypes of human breast cancer.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17274988 2007 ALK activation induces Shc and FRS2 recruitment: Signaling and phenotypic outcomes in PC12 cells differentiation.
17077326 2007 Gene-expression profiling of systemic anaplastic large-cell lymphoma reveals differences based on ALK status and two distinct morphologic ALK+ subtypes.
17071493 2006 CD26, together with cell surface adenosine deaminase, is selectively expressed on ALK-positive, but not on ALK-negative, anaplastic large cell lymphoma and Hodgkin's lymphoma.
16880530 2006 Anaplastic lymphoma kinase is a dependence receptor whose proapoptotic functions are activated by caspase cleavage.
16878150 2007 Recruitment of insulin receptor substrate-1 and activation of NF-kappaB essential for midkine growth signaling through anaplastic lymphoma kinase.
16835382 2006 A "liaison dangereuse" between AUF1/hnRNPD and the oncogenic tyrosine kinase NPM-ALK.
16825495 2006 Loss of SHP1 enhances JAK3/STAT3 signaling and decreases proteosome degradation of JAK3 and NPM-ALK in ALK+ anaplastic large-cell lymphoma.
16766651 2006 Nucleophosmin/anaplastic lymphoma kinase (NPM/ALK) oncoprotein induces the T regulatory cell phenotype by activating STAT3.
16709933 2006 NPM-ALK-dependent expression of the transcription factor CCAAT/enhancer binding protein beta in ALK-positive anaplastic large cell lymphoma.
16651537 2006 Proteomic identification of oncogenic chromosomal translocation partners encoding chimeric anaplastic lymphoma kinase fusion proteins.
16623783 2006 ALK expression in pseudosarcomatous myofibroblastic proliferations of the genitourinary tract.
16604305 2006 Possible association between nonsynonymous polymorphisms of the anaplastic lymphoma kinase (ALK) gene and schizophrenia in a Japanese population.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16317043 2005 Role of the subcellular localization of ALK tyrosine kinase domain in neuronal differentiation of PC12 cells.
16254137 2006 Anaplastic lymphoma kinase activity is essential for the proliferation and survival of anaplastic large-cell lymphoma cells.
16161041 2006 Fusion of the SEC31L1 and ALK genes in an inflammatory myofibroblastic tumor.
16153455 2005 Jak3 activation is significantly associated with ALK expression in anaplastic large cell lymphoma.
15938644 2005 Unique substrate specificity of anaplastic lymphoma kinase (ALK): development of phosphoacceptor peptides for the assay of ALK activity.
15933425 2005 ALK-positive neutrophil-rich variant of anaplastic large cell lymphoma diagnosed after head trauma.
15928040 2005 Activation of alpha-diacylglycerol kinase is critical for the mitogenic properties of anaplastic lymphoma kinase.
15908427 2005 Differential induction of glioblastoma migration and growth by two forms of pleiotrophin.
15886198 2005 Activation and inhibition of anaplastic lymphoma kinase receptor tyrosine kinase by monoclonal antibodies and absence of agonist activity of pleiotrophin.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15713979 2005 The role of p53 and anaplastic lymphoma kinase genes in the progression of cutaneous CD30(+) lymphoproliferative diseases.
15680399 2005 Truncated ALK derived from chromosomal translocation t(2;5)(p23;q35) binds to the SH3 domain of p85-PI3K.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15583856 2004 The emerging normal and disease-related roles of anaplastic lymphoma kinase.
15226403 2004 ALK receptor tyrosine kinase promotes cell growth and neurite outgrowth.
15161657 2004 Signal transducer and activator of transcription-3 activation contributes to high tissue inhibitor of metalloproteinase-1 expression in anaplastic lymphoma kinase-positive anaplastic large cell lymphoma.
15004538 2004 High-dose therapy and autologous stem cell transplant does not result in long-term disease-free survival in patients with recurrent chemotherapy-sensitive ALK-negative anaplastic large-cell lymphoma.
14962911 2004 NPM-ALK fusion kinase of anaplastic large-cell lymphoma regulates survival and proliferative signaling through modulation of FOXO3a.
14656879 2004 Bcl-XL down-regulation suppresses the tumorigenic potential of NPM/ALK in vitro and in vivo.
14563642 2004 Nucleophosmin-anaplastic lymphoma kinase of anaplastic large-cell lymphoma recruits, activates, and uses pp60c-src to mediate its mitogenicity.
12800156 2003 Non-muscle myosin heavy chain (MYH9): a new partner fused to ALK in anaplastic large cell lymphoma.
12763927 2003 ALK-positive diffuse large B-cell lymphoma is associated with Clathrin-ALK rearrangements: report of 6 cases.
12213716 2002 The nucleophosmin-anaplastic lymphoma kinase fusion protein induces c-Myc expression in pediatric anaplastic large cell lymphomas.
12185581 2002 Activation of anaplastic lymphoma kinase is responsible for hyperphosphorylation of ShcC in neuroblastoma cell lines.
12122009 2002 Midkine binds to anaplastic lymphoma kinase (ALK) and acts as a growth factor for different cell types.
12112524 2002 Identification of novel fusion partners of ALK, the anaplastic lymphoma kinase, in anaplastic large-cell lymphoma and inflammatory myofibroblastic tumor.
12107166 2002 Anti-apoptotic signaling of pleiotrophin through its receptor, anaplastic lymphoma kinase.
12036886 2002 Expression levels of apoptosis-related proteins predict clinical outcome in anaplastic large cell lymphoma.
11943732 2002 Diversity of genomic breakpoints in TFG-ALK translocations in anaplastic large cell lymphomas: identification of a new TFG-ALK(XL) chimeric gene with transforming activity.
11888936 2002 Nucleophosmin-anaplastic lymphoma kinase (NPM-ALK), a novel Hsp90-client tyrosine kinase: down-regulation of NPM-ALK expression and tyrosine phosphorylation in ALK(+) CD30(+) lymphoma cells by the Hsp90 antagonist 17-allylamino,17-demethoxygeldanamycin.
11850821 2002 Anaplastic lymphoma kinase (ALK) activates Stat3 and protects hematopoietic cells from cell death.
11809760 2002 Pleiotrophin signaling through anaplastic lymphoma kinase is rate-limiting for glioblastoma growth.
11387242 2001 The cytoplasmic truncated receptor tyrosine kinase ALK homodimer immortalizes and cooperates with ras in cellular transformation.
11278720 2001 Identification of anaplastic lymphoma kinase as a receptor for the growth factor pleiotrophin.
11121404 2001 Activation of anaplastic lymphoma kinase receptor tyrosine kinase induces neuronal differentiation through the mitogen-activated protein kinase pathway.
10556217 1999 TRK-fused gene (TFG) is a new partner of ALK in anaplastic large cell lymphoma producing two structurally different TFG-ALK translocations.
9819383 1998 Nucleophosmin-anaplastic lymphoma kinase of large-cell anaplastic lymphoma is a constitutively active tyrosine kinase that utilizes phospholipase C-gamma to mediate its mitogenicity.
9490693 1998 ALK-positive lymphoma: a single disease with a broad spectrum of morphology.
9174053 1997 ALK, the chromosome 2 gene locus altered by the t(2;5) in non-Hodgkin's lymphoma, encodes a novel neural receptor tyrosine kinase that is highly related to leukocyte tyrosine kinase (LTK)
9053841 1997 Molecular characterization of ALK, a receptor tyrosine kinase expressed specifically in the nervous system.
8633037 1996 Characterization of the transforming activity of p80, a hyperphosphorylated protein in a Ki-1 lymphoma cell line with chromosomal translocation t(2;5).
8122112 1994 Fusion of a kinase gene, ALK, to a nucleolar protein gene, NPM, in non-Hodgkin's lymphoma.