Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6GMV1 D3DNA5
Symbols ALG1L1

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
OMA EggNOG

AA Sequence

MERSAFMELDAGSRLVMHLREWPALLVSSTGWTEFEQLTLDGHNLPSLVCVITGSVDLGVCLHMSSSGLD      1 - 70
LPMKVVDMFGCCLPVCAVNFKCLHELVKHEENGLVFEDSEELAALQMLFSNFPDPAGKLNQFWKNLRESQ     71 - 140
QLRWDESWVQTVLPLVMDIQLLGQRLKPRDPCCPSRSFFSESQGKPF                           141 - 187
//

Text Mined References (4)

PMID Year Title