Property Summary

NCBI Gene PubMed Count 11
PubMed Score 6.77
PubTator Score 1.50

Knowledge Summary


No data available


  Differential Expression (9)

Disease log2 FC p
esophageal adenocarcinoma -2.900 1.8e-02
psoriasis 2.400 2.2e-07
non-small cell lung cancer 2.168 1.4e-13
interstitial cystitis -1.800 4.9e-04
cystic fibrosis 1.300 4.7e-04
nasopharyngeal carcinoma -1.300 4.9e-05
ductal carcinoma in situ 3.400 8.4e-04
invasive ductal carcinoma 2.600 1.7e-02
ovarian cancer 1.500 2.2e-03

Protein-protein Interaction (1)

Gene RIF (2)

20237496 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

PSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL                                       351 - 385

Text Mined References (12)

PMID Year Title
25286108 2015 Mouse aldehyde dehydrogenase ALDH3B2 is localized to lipid droplets via two C-terminal tryptophan residues and lipid modification.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
9161417 1997 Human aldehyde dehydrogenase genes, ALDH7 and ALDH8: genomic organization and gene structure comparison.
8890755 1996 Sequencing and expression of the human ALDH8 encoding a new member of the aldehyde dehydrogenase family.
7484374 1995 Cloning and characterization of genes encoding four additional human aldehyde dehydrogenase isozymes.