| Tchem | Aldehyde dehydrogenase family 3 member B2 |
Oxidizes medium and long chain aldehydes into non-toxic fatty acids.
This gene encodes a member of the aldehyde dehydrogenase family, a group of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The gene of this particular family member is over 10 kb in length. The expression of these transcripts is restricted to the salivary gland among the human tissues examined. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]
This gene encodes a member of the aldehyde dehydrogenase family, a group of isozymes that may play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The gene of this particular family member is over 10 kb in length. The expression of these transcripts is restricted to the salivary gland among the human tissues examined. Alternate transcriptional splice variants have been characterized. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| non-small cell lung cancer | 2798 | 1.4e-13 |
| psoriasis | 6685 | 2.2e-07 |
| nasopharyngeal carcinoma | 1056 | 4.9e-05 |
| cystic fibrosis | 1670 | 4.7e-04 |
| interstitial cystitis | 2299 | 4.9e-04 |
| ductal carcinoma in situ | 1745 | 8.4e-04 |
| ovarian cancer | 8491 | 2.2e-03 |
| invasive ductal carcinoma | 2950 | 1.7e-02 |
| esophageal adenocarcinoma | 737 | 1.8e-02 |
| Disease | log2 FC | p |
|---|---|---|
| esophageal adenocarcinoma | -2.900 | 1.8e-02 |
| psoriasis | 2.400 | 2.2e-07 |
| non-small cell lung cancer | 2.168 | 1.4e-13 |
| interstitial cystitis | -1.800 | 4.9e-04 |
| cystic fibrosis | 1.300 | 4.7e-04 |
| nasopharyngeal carcinoma | -1.300 | 4.9e-05 |
| ductal carcinoma in situ | 3.400 | 8.4e-04 |
| invasive ductal carcinoma | 2.600 | 1.7e-02 |
| ovarian cancer | 1.500 | 2.2e-03 |
MKDEPRSTNLFMKLDSVFIWKEPFGLVLIIAPWNYPLNLTLVLLVGALAAGSCVVLKPSEISQGTEKVLA 1 - 70 EVLPQYLDQSCFAVVLGGPQETGQLLEHKLDYIFFTGSPRVGKIVMTAATKHLTPVTLELGGKNPCYVDD 71 - 140 NCDPQTVANRVAWFCYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGHIINQKQF 141 - 210 QRLRALLGCSRVAIGGQSNESDRYIAPTVLVDVQETEPVMQEEIFGPILPIVNVQSVDEAIKFINRQEKP 211 - 280 LALYAFSNSSQVVNQMLERTSSGSFGGNEGFTYISLLSVPFGGVGHSGMGRYHGKFTFDTFSHHRTCLLA 281 - 350 PSGLEKLKEIHYPPYTDWNQQLLRWGMGSQSCTLL 351 - 385 //
| PMID | Year | Title | |
|---|---|---|---|
| 25286108 | 2015 | Mouse aldehyde dehydrogenase ALDH3B2 is localized to lipid droplets via two C-terminal tryptophan residues and lipid modification. | |
| 20237496 | 2010 | New genetic associations detected in a host response study to hepatitis B vaccine. | |
| 19343046 | 2009 | Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects. | |
| 16554811 | 2006 | Human chromosome 11 DNA sequence and analysis including novel gene identification. | |
| 15489334 | 2004 | The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | |
| 15342556 | 2004 | Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions. | |
| 14702039 | 2004 | Complete sequencing and characterization of 21,243 full-length human cDNAs. | |
| 12477932 | 2002 | Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences. | |
| 10737800 | 2000 | Shotgun sequencing of the human transcriptome with ORF expressed sequence tags. | |
| 9161417 | 1997 | Human aldehyde dehydrogenase genes, ALDH7 and ALDH8: genomic organization and gene structure comparison. | |
| 8890755 | 1996 | Sequencing and expression of the human ALDH8 encoding a new member of the aldehyde dehydrogenase family. | |
| 7484374 | 1995 | Cloning and characterization of genes encoding four additional human aldehyde dehydrogenase isozymes. |
