Property Summary

NCBI Gene PubMed Count 54
PubMed Score 54.10
PubTator Score 71.09

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
nephrosclerosis -1.495 2.2e-02
osteosarcoma 1.294 4.0e-05
glioblastoma -1.100 5.9e-03
group 3 medulloblastoma -2.800 7.5e-07
atypical teratoid/rhabdoid tumor -1.700 1.4e-03
medulloblastoma, large-cell -2.700 1.3e-06
primitive neuroectodermal tumor -1.700 4.2e-03
adrenocortical carcinoma -1.680 3.1e-03
pancreatic ductal adenocarcinoma liver m... -1.501 4.8e-02
interstitial cystitis -2.900 1.7e-06
posterior fossa group A ependymoma 1.400 7.3e-08
ductal carcinoma in situ -2.600 1.3e-04
invasive ductal carcinoma -2.800 8.3e-04
ulcerative colitis 1.100 4.4e-02
psoriasis -2.200 3.0e-34

Protein-protein Interaction (2)

Gene RIF (32)

PMID Text
26567272 Data suggest that isoforms of FTHFD occur both in mitochondria and in cytosol; activity of cytosolic FTHFD appears to respond to supply of one-carbon groups in excess of those required for classical one-carbon metabolism. [REVIEW]
25077544 JNK1/2 phosphorylate Bid at Thr59 within the caspase cleavage site in response to ALDH1L1.
24953984 ALDH1 is indicative of stemness and is a biomarker marker in colon cancer.
24651765 one variant in the ALDH1L1 locus, rs2364368, was associated with incident ischemic stroke.
21987076 The results in this study, for the first time, reveal that the mRNA and protein expressions of ALDH1L1 are significantly reduced in hepatocellular carcinoma tissues
21540484 Conserved catalytic residues of the ALDH1L1 aldehyde dehydrogenase domain control binding and discharging of the coenzyme.
21046559 These studies support ALDH1L1 as a general CNS astroglial marker.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20737570 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20729910 inhibition of cell motility by ALDH1L1 associated with dephosphorylation of the actin depolymerizing factor cofilin by PP1 and PP2A
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20198315 Observational study of gene-disease association. (HuGE Navigator)
19936946 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)
19625176 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19161160 Observational study of gene-disease association. (HuGE Navigator)
19064578 None of the snps that defined 3 separate haplotype blocks in the FTHFD gene, rs2365004, rs11923466, rs2886059, rs10934751, rs2276731, rs1823213 and rs4646701 were associated with prostate cancer risk.
19064578 Observational study of gene-disease association. (HuGE Navigator)
19048631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18830263 Observational study of gene-disease association. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
17891500 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
17548676 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17119116 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
12805405 FDH antiproliferative effects on A549 cells include both G(1) cell cycle arrest and caspase-dependent apoptosis
12065246 down-regulation of FDH in tumors is proposed to be one of the cellular mechanisms that enhance proliferation.

AA Sequence

MKIAVIGQSLFGQEVYCHLRKEGHEVVGVFTVPDKDGKADPLGLEAEKDGVPVFKYSRWRAKGQALPDVV      1 - 70
AKYQALGAELNVLPFCSQFIPMEIISAPRHGSIIYHPSLLPRHRGASAINWTLIHGDKKGGFSIFWADDG     71 - 140
LDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAVRLIAEGKAPRLPQPEEGATYEGIQKKETAK    141 - 210
INWDQPAEAIHNWIRGNDKVPGAWTEACEQKLTFFNSTLNTSGLVPEGDALPIPGAHRPGVVTKAGLILF    211 - 280
GNDDKMLLVKNIQLEDGKMILASNFFKGAASSVLELTEAELVTAEAVRSVWQRILPKVLEVEDSTDFFKS    281 - 350
GAASVDVVRLVEEVKELCDGLELENEDVYMASTFGDFIQLLVRKLRGDDEEGECSIDYVEMAVNKRTVRM    351 - 420
PHQLFIGGEFVDAEGAKTSETINPTDGSVICQVSLAQVTDVDKAVAAAKDAFENGRWGKISARDRGRLMY    421 - 490
RLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKIQGSTIPINQARPNRNLTLTR    491 - 560
KEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQVTPLTALKFAELTLKAGIPKGVVNVLPGSG    561 - 630
SLVGQRLSDHPDVRKIGFTGSTEVGKHIMKSCAISNVKKVSLELGGKSPLIIFADCDLNKAVQMGMSSVF    631 - 700
FNKGENCIAAGRLFVEDSIHDEFVRRVVEEVRKMKVGNPLDRDTDHGPQNHHAHLVKLMEYCQHGVKEGA    701 - 770
TLVCGGNQVPRPGFFFEPTVFTDVEDHMFIAKEESFGPVMIISRFADGDLDAVLSRANATEFGLASGVFT    771 - 840
RDINKALYVSDKLQAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY            841 - 902
//

Text Mined References (61)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26567272 2015 Division of labour: how does folate metabolism partition between one-carbon metabolism and amino acid oxidation?
25114248 2014 Distinct isoform of FABP7 revealed by screening for retroelement-activated genes in diffuse large B-cell lymphoma.
25077544 2014 JNK1/2 regulate Bid by direct phosphorylation at Thr59 in response to ALDH1L1.
24953984 2014 The impact of Aldehyde dehydrogenase 1 expression on prognosis for metastatic colon cancer.
24651765 2014 Genome-wide meta-analysis of homocysteine and methionine metabolism identifies five one carbon metabolism loci and a novel association of ALDH1L1 with ischemic stroke.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23378610 2013 Genetic variants associated with glycine metabolism and their role in insulin sensitivity and type 2 diabetes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22593801 2011 Activation of p21-Dependent G1/G2 Arrest in the Absence of DNA Damage as an Antiapoptotic Response to Metabolic Stress.
22491060 2012 Genetic and epigenetic analysis of non-small cell lung cancer with NotI-microarrays.
22039442 2011 Comprehensive evaluation of one-carbon metabolism pathway gene variants and renal cell cancer risk.
21987076 2012 Decreased expression of ALDH1L1 is associated with a poor prognosis in hepatocellular carcinoma.
21779486 2011 Epigenetic Silencing of ALDH1L1, a Metabolic Regulator of Cellular Proliferation, in Cancers.
21540484 2011 Conserved catalytic residues of the ALDH1L1 aldehyde dehydrogenase domain control binding and discharging of the coenzyme.
21238436 2011 Enzymatic properties of ALDH1L2, a mitochondrial 10-formyltetrahydrofolate dehydrogenase.
21215736 2011 Phylogeny and evolution of aldehyde dehydrogenase-homologous folate enzymes.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20737570 2010 Genetic variants in one-carbon metabolism-related genes contribute to NSCLC prognosis in a Chinese population.
20729910 2010 ALDH1L1 inhibits cell motility via dephosphorylation of cofilin by PP1 and PP2A.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20498374 2010 ALDH1L2 is the mitochondrial homolog of 10-formyltetrahydrofolate dehydrogenase.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
19936946 2010 Germline polymorphisms in the one-carbon metabolism pathway and DNA methylation in colorectal cancer.
19935739 2011 Identification of blood biomarkers for psychosis using convergent functional genomics.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19447584 2009 Subcortical oligodendrocyte- and astrocyte-associated gene expression in subjects with schizophrenia, major depression and bipolar disorder.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
19064578 2008 No association of single nucleotide polymorphisms in one-carbon metabolism genes with prostate cancer risk.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19048631 2009 Oral facial clefts and gene polymorphisms in metabolism of folate/one-carbon and vitamin A: a pathway-wide association study.
19018242 2008 Gene expression profiling of NF-1-associated and sporadic pilocytic astrocytoma identifies aldehyde dehydrogenase 1 family member L1 (ALDH1L1) as an underexpressed candidate biomarker in aggressive subtypes.
18848533 2009 FDH: an aldehyde dehydrogenase fusion enzyme in folate metabolism.
18830263 2009 Polymorphisms in DNA repair and one-carbon metabolism genes and overall survival in diffuse large B-cell lymphoma and follicular lymphoma.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17891500 2007 One-carbon metabolism gene polymorphisms and risk of non-Hodgkin lymphoma in Australia.
17548676 2007 Association of polymorphisms in one-carbon metabolism genes and postmenopausal breast cancer incidence.
17119116 2007 Gene-nutrient interactions among determinants of folate and one-carbon metabolism on the risk of non-Hodgkin lymphoma: NCI-SEER case-control study.
17111379 2007 The folate metabolic enzyme ALDH1L1 is restricted to the midline of the early CNS, suggesting a role in human neural tube defects.
17057331 2006 Structures of the hydrolase domain of human 10-formyltetrahydrofolate dehydrogenase and its complex with a substrate analogue.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12805405 2003 Ectopic expression of 10-formyltetrahydrofolate dehydrogenase in A549 cells induces G1 cell cycle arrest and apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12065246 2002 10-formyltetrahydrofolate dehydrogenase, one of the major folate enzymes, is down-regulated in tumor tissues and possesses suppressor effects on cancer cells.
10204077 1999 Isolation and characterization of cDNA clone for human liver 10-formyltetrahydrofolate dehydrogenase.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7972060 1994 Identification of a heritable deficiency of the folate-dependent enzyme 10-formyltetrahydrofolate dehydrogenase in mice.
2733692 1989 Studies on the mechanism of methanol poisoning: purification and comparison of rat and human liver 10-formyltetrahydrofolate dehydrogenase.