Property Summary

Ligand Count 281
NCBI Gene PubMed Count 250
PubMed Score 332.49
PubTator Score 282.24

Knowledge Summary

Patent (36,100)

TINX Plot

  Disease (7)

Expression

  Differential Expression (5)

Disease log2 FC p
ependymoma 1.100 1.4e-02
osteosarcoma 1.206 4.8e-05
ovarian cancer -1.200 2.3e-05
pancreatic ductal adenocarcinoma liver m... -1.064 1.1e-02
subependymal giant cell astrocytoma -1.238 3.8e-02

Protein-protein Interaction (6)

Gene RIF (244)

AA Sequence

MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAECQLMKTERPRP      1 - 70
NTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPMDYKCGSPSDSSTTEEMEVAV     71 - 140
SKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIIAKDEVAHTVTESRVLQNTRHP    141 - 210
FLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLEN    211 - 280
LMLDKDGHIKITDFGLCKEGISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPF    281 - 350
YNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK    351 - 420
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIRE             421 - 481
//

Text Mined References (267)

PMID Year Title