Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.77
PubTator Score 25.69

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
ovarian cancer 8491 1.5e-08
osteosarcoma 7933 2.1e-08
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 192 0.0 1.0
Disease Target Count Z-score Confidence
Cerebrotendinous xanthomatosis 12 4.124 2.1


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.406 2.1e-08
ovarian cancer 1.100 1.5e-08


Accession Q96JD6 Q86Z16 Q86Z17 Q86Z18 Q9BU71 AF reductase
Symbols hTSP


PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

16385451 Observational study of gene-disease association. (HuGE Navigator)
15118078 results indicate that the expression of human testis aldo-keto reductase, down-regulated in the testicular tumour, is possibly controlled by mitogenic and hormonal signals

AA Sequence

FDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHIEY                                  281 - 320

Text Mined References (15)

PMID Year Title
25085501 2014 Integrated genome-wide association, coexpression network, and expression single nucleotide polymorphism analysis identifies novel pathway in allergic rhinitis.
24827717 2014 Genome wide association study: searching for genes underlying body mass index in the Chinese.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20662065 2010 Identification of candidate loci at 6p21 and 21q22 in a genome-wide association study of cardiac manifestations of neonatal lupus.
19706366 2009 Aldo-keto reductase (AKR) superfamily: genomics and annotation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15118078 2004 Characterization of htAKR, a novel gene product in the aldo-keto reductase family specifically expressed in human testis.
12604216 2003 Human testis specific protein: a new member of aldo-keto reductase superfamily.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.