Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.02
PubTator Score 25.69

Knowledge Summary


No data available


  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 1.5e-08
osteosarcoma 7950 2.1e-08
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 1.1
Disease Target Count Z-score Confidence
Cerebrotendinous xanthomatosis 13 4.142 2.1
Hypotrichosis 1 15 3.078 1.5


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.406 2.1e-08
ovarian cancer 1.100 1.5e-08


Accession Q96JD6 Q86Z16 Q86Z17 Q86Z18 Q9BU71 AF reductase
Symbols TAKR


PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

FDFELTQHDMDNILSLNRNLRLAMFPITKNHKDYPFHIEY                                  281 - 320

Text Mined References (15)

PMID Year Title