Property Summary

NCBI Gene PubMed Count 41
PubMed Score 181.16
PubTator Score 148.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Gene RIF (18)

PMID Text
26437602 Functional characterization revealed an undescribed role for AMPK-dependent phosphorylation of AKAP1 in mitochondrial respiration.
24813785 AKAP 149-PKA-PDE4A complex localization is related with YTX effect in K-562 cell line
23557075 In the case of the beta2AR, this process is facilitated by the presence of A-Kinase Anchoring Proteins (AKAPs) that serve as scaffolding proteins for the L-type calcium channel and the beta2AR complex.
23077346 AKAP1 anchors Star mRNA at the mitochondria, thus stabilizing the translational complex at this organelle, a situation that might affect STAR production and steroidogenesis.
23045525 Shp2 is a component of the AKAP-Lbc complex and is inhibited by protein kinase A under pathological hypertrophic conditions in the heart.
22807343 In tumoural lymphocytes, yessotoxin decreases AKAP149 cytosolic expression and increases cAMP levels which leads to cell death.
21994574 AKAP149 is an HIV-1 RT binding protein. Amino acids 375-645 of APAK149 and amino acids 464-541 of HIV-1 RT p66 are involved in the binding between APAK149 and RT p66. A single-point mutant RT G462R fails to carry out reverse transcription
20877624 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
19750561 AKAP149 is an HIV-1 RT binding protein. Amino acids 375-645 of APAK149 and amino acids 464-541 of HIV-1 RT p66 are involved in the binding between APAK149 and RT p66. A single-point mutant RT G462R fails to carry out reverse transcription
19074462 Protein phosphatase 1 binding occurs through a conserved RVXF motif found in the KH domain of AKAP149.
18786546 Results suggest that the interaction between reverse transcriptase and AKAP149 in infected cells may play an important role in HIV-1 reverse transcription.
18786546 AKAP149 is an HIV-1 RT binding protein. Amino acids 375-645 of APAK149 and amino acids 464-541 of HIV-1 RT p66 are involved in the binding between APAK149 and RT p66. A single-point mutant RT G462R fails to carry out reverse transcription
18625701 both the constitutive and cAMP-induced release of TNFR1 exosome-like vesicles occur via PKA-dependent pathways that are regulated by the anchoring of RIIbeta to BIG2 via AKAP domains B and C
17884635 DAKAP1alpha overexpression induced regulatory (R) or catalytic (C) subunits of PKA to outer mitochondrial colocalization and showed similar regulation
12697839 AKAP149-regulated PP1 activity at the NE during G1 is required to maintain nuclear integrity and cell survival.
12634056 RIalpha and RIbeta homodimers as well as an RIalpha:RIbeta heterodimer and several of the mutants were able to bind to the R-binding domain of AKAP149/D-AKAP1
12414807 AMY-1 interacts with this and AKAP95 in the cytoplasm and the nucleus, respectively, and inhibits cAMP-dependent protein kinase activity by preventing binding of its catalytic subunit to A-kinase-anchoring protein (AKAP) complex.

AA Sequence

MAIQFRSLFPLALPGMLALLGWWWFFSRKKGHVSSHDEQQVEAGAVQLRADPAIKEPLPVEDVCPKVVST      1 - 70
PPSVTEPPEKELSTVSKLPAEPPALLQTHPPCRRSESSGILPNTTDMRLRPGTRRDDSTKLELALTGGEA     71 - 140
KSIPLECPLSSPKGVLFSSKSAEVCKQDSPFSRVPRKVQPGYPVVPAEKRSSGERARETGGAEGTGDAVL    141 - 210
GEKVLEEALLSREHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELA    211 - 280
KDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQ    281 - 350
IISQVISEATEQVLATTVGKVAGRVCQASQLQGQKEESCVPVHQKTVLGPDTAEPATAEAAVAPPDAGLP    351 - 420
LPGLPAEGSPPPKTYVSCLKSLLSSPTKDSKPNISAHHISLASCLALTTPSEELPDRAGILVEDATCVTC    421 - 490
MSDSSQSVPLVASPGHCSDSFSTSGLEDSCTETSSSPRDKAITPPLPESTVPFSNGVLKGELSDLGAEDG    491 - 560
WTMDAEADHSGGSDRNSMDSVDSCCSLKKTESFQNAQAGSNPKKVDLIIWEIEVPKHLVGRLIGKQGRYV    561 - 630
SFLKQTSGAKIYISTLPYTQSVQICHIEGSQHHVDKALNLIGKKFKELNLTNIYAPPLPSLALPSLPMTS    631 - 700
WLMLPDGITVEVIVVNQVNAGHLFVQQHTHPTFHALRSLDQQMYLCYSQPGIPTLPTPVEITVICAAPGA    701 - 770
DGAWWRAQVVASYEETNEVEIRYVDYGGYKRVKVDVLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSP    771 - 840
EADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYYTSL           841 - 903
//

Text Mined References (51)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26437602 2015 Global Phosphoproteomic Analysis of Human Skeletal Muscle Reveals a Network of Exercise-Regulated Kinases and AMPK Substrates.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24813785 2014 Role of AKAP 149-PKA-PDE4A complex in cell survival and cell differentiation processes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24083380 2013 Differential PKA activation and AKAP association determines cell fate in cancer cells.
23557075 2013 A macromolecular trafficking complex composed of ??-adrenergic receptors, A-Kinase Anchoring Proteins and L-type calcium channels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23077346 2012 Short RNA molecules with high binding affinity to the KH motif of A-kinase anchoring protein 1 (AKAP1): implications for the regulation of steroidogenesis.
23045525 2012 Src homology 2 domain-containing phosphatase 2 (Shp2) is a component of the A-kinase-anchoring protein (AKAP)-Lbc complex and is inhibited by protein kinase A (PKA) under pathological hypertrophic conditions in the heart.
22807343 2012 Role of yessotoxin in calcium and cAMP-crosstalks in primary and K-562 human lymphocytes: the effect is mediated by anchor kinase A mitochondrial proteins.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19074462 2009 Mutually exclusive binding of PP1 and RNA to AKAP149 affects the mitochondrial network.
18786546 2008 AKAP149 binds to HIV-1 reverse transcriptase and is involved in the reverse transcription.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18625701 2008 cAMP-dependent protein kinase A (PKA) signaling induces TNFR1 exosome-like vesicle release via anchoring of PKA regulatory subunit RIIbeta to BIG2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17911601 2007 Inhibition of T cell activation by cyclic adenosine 5'-monophosphate requires lipid raft targeting of protein kinase A type I by the A-kinase anchoring protein ezrin.
17884635 2007 Isoform-specific PKA dynamics revealed by dye-triggered aggregation and DAKAP1alpha-mediated localization in living cells.
16642035 2006 An anchored PKA and PDE4 complex regulates subplasmalemmal cAMP dynamics.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15143158 2004 Mitochondrial AKAP121 binds and targets protein tyrosine phosphatase D1, a novel positive regulator of src signaling.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12697839 2003 AKAP149 is a novel PP1 specifier required to maintain nuclear envelope integrity in G1 phase.
12634056 2003 A kinase anchoring protein (AKAP) interaction and dimerization of the RIalpha and RIbeta regulatory subunits of protein kinase a in vivo by the yeast two hybrid system.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12414807 2002 AMY-1 interacts with S-AKAP84 and AKAP95 in the cytoplasm and the nucleus, respectively, and inhibits cAMP-dependent protein kinase activity by preventing binding of its catalytic subunit to A-kinase-anchoring protein (AKAP) complex.
12223483 2002 AAT-1, a novel testis-specific AMY-1-binding protein, forms a quaternary complex with AMY-1, A-kinase anchor protein 84, and a regulatory subunit of cAMP-dependent protein kinase and is phosphorylated by its kinase.
11807172 2002 AKAP mediated signal transduction.
11546661 2001 Two distinct caveolin-1 domains mediate the functional interaction of caveolin-1 with protein kinase A.
11483602 2001 AMY-1, a c-Myc-binding protein, is localized in the mitochondria of sperm by association with S-AKAP84, an anchor protein of cAMP-dependent protein kinase.
10995432 2000 Recruitment of protein phosphatase 1 to the nuclear envelope by A-kinase anchoring protein AKAP149 is a prerequisite for nuclear lamina assembly.
10764601 2000 Analysis of A-kinase anchoring protein (AKAP) interaction with protein kinase A (PKA) regulatory subunits: PKA isoform specificity in AKAP binding.
10352013 1999 NH2-Terminal targeting motifs direct dual specificity A-kinase-anchoring protein 1 (D-AKAP1) to either mitochondria or endoplasmic reticulum.
9238861 1997 Anchoring and scaffold proteins for kinases and phosphatases.
9065479 1997 Identification of a novel protein kinase A anchoring protein that binds both type I and type II regulatory subunits.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8769136 1996 Molecular characterization of AKAP149, a novel A kinase anchor protein with a KH domain.
7499250 1995 Characterization of S-AKAP84, a novel developmentally regulated A kinase anchor protein of male germ cells.