Property Summary

NCBI Gene PubMed Count 62
PubMed Score 97.54
PubTator Score 130.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.9
Disease Target Count Z-score Confidence
Multiple Sclerosis 527 0.0 3.0
Type 2 diabetes mellitus 268 0.0 2.3

Expression

  Differential Expression (15)

Disease log2 FC p
glioblastoma -1.500 5.9e-07
group 4 medulloblastoma 1.200 1.2e-03
intraductal papillary-mucinous adenoma (... 1.800 1.7e-04
intraductal papillary-mucinous carcinoma... 1.500 1.0e-03
lung cancer -1.200 1.4e-03
lung carcinoma 1.800 5.5e-30
medulloblastoma, large-cell -1.500 1.8e-04
non-small cell lung cancer -1.087 2.4e-14
osteosarcoma 1.084 5.1e-03
ovarian cancer -2.000 7.7e-09
pediatric high grade glioma -1.300 1.6e-06
Pick disease -2.000 5.2e-05
progressive supranuclear palsy -1.200 3.0e-02
psoriasis -1.900 4.6e-05
tuberculosis -1.300 9.1e-04

 OMIM Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (50)

AA Sequence

MPTAESEAKVKTKVRFEELLKTHSDLMREKKKLKKKLVRSEENISPDTIRSNLHYMKETTSDDPDTIRSN      1 - 70
LPHIKETTSDDVSAANTNNLKKSTRVTKNKLRNTQLATENPNGDASVEEDKQGKPNKKVIKTVPQLTTQD     71 - 140
LKPETPENKVDSTHQKTHTKPQPGVDHQKSEKANEGREETDLEEDEELMQAYQCHVTEEMAKEIKRKIRK    141 - 210
KLKEQLTYFPSDTLFHDDKLSSEKRKKKKEVPVFSKAETSTLTISGDTVEGEQKKESSVRSVSSDSHQDD    211 - 280
EISSMEQSTEDSMQDDTKPKPKKTKKKTKAVADNNEDVDGDGVHEITSRDSPVYPKCLLDDDLVLGVYIH    281 - 350
RTDRLKSDFMISHPMVKIHVVDEHTGQYVKKDDSGRPVSSYYEKENVDYILPIMTQPYDFKQLKSRLPEW    351 - 420
EEQIVFNENFPYLLRGSDESPKVILFFEILDFLSVDEIKNNSEVQNQECGFRKIAWAFLKLLGANGNANI    421 - 490
NSKLRLQLYYPPTKPRSPLSVVEAFEWWSKCPRNHYPSTLYVTVRGLKVPDCIKPSYRSMMALQEEKGKP    491 - 560
VHCERHHESSSVDTEPGLEESKEVIKWKRLPGQACRIPNKHLFSLNAGERGCFCLDFSHNGRILAAACAS    561 - 630
RDGYPIILYEIPSGRFMRELCGHLNIIYDLSWSKDDHYILTSSSDGTARIWKNEINNTNTFRVLPHPSFV    631 - 700
YTAKFHPAVRELVVTGCYDSMIRIWKVEMREDSAILVRQFDVHKSFINSLCFDTEGHHMYSGDCTGVIVV    701 - 770
WNTYVKINDLEHSVHHWTINKEIKETEFKGIPISYLEIHPNGKRLLIHTKDSTLRIMDLRILVARKFVGA    771 - 840
ANYREKIHSTLTPCGTFLFAGSEDGIVYVWNPETGEQVAMYSDLPFKSPIRDISYHPFENMVAFCAFGQN    841 - 910
EPILLYIYDFHVAQQEAEMFKRYNGTFPLPGIHQSQDALCTCPKLPHQGSFQIDEFVHTESSSTKMQLVK    911 - 980
QRLETVTEVIRSCAAKVNKNLSFTSPPAVSSQQSKLKQSNMLTAQEILHQFGFTQTGIISIERKPCNHQV    981 - 1050
DTAPTVVALYDYTANRSDELTIHRGDIIRVFFKDNEDWWYGSIGKGQEGYFPANHVASETLYQELPPEIK   1051 - 1120
ERSPPLSPEEKTKIEKSPAPQKQSINKNKSQDFRLGSESMTHSEMRKEQSHEDQGHIMDTRMRKNKQAGR   1121 - 1190
KVTLIE                                                                   1191 - 1196
//

Text Mined References (63)

PMID Year Title