Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.91
PubTator Score 7.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.700 1.5e-04
Astrocytoma, Pilocytic -1.300 1.1e-05
atypical teratoid / rhabdoid tumor -1.900 5.2e-08
glioblastoma -1.300 5.5e-05
group 4 medulloblastoma -1.500 4.0e-05
intraductal papillary-mucinous adenoma (... 1.400 4.9e-03
intraductal papillary-mucinous neoplasm ... 1.700 9.9e-03
medulloblastoma, large-cell -2.300 6.2e-07
osteosarcoma 1.476 3.3e-06
ovarian cancer -1.600 1.3e-04
Pick disease 1.200 3.1e-06
primitive neuroectodermal tumor -1.500 2.4e-04
psoriasis 1.400 5.0e-03
Rheumatoid arthritis 1.400 2.2e-04
tuberculosis 1.100 9.0e-06

Protein-protein Interaction (4)

Gene RIF (5)

AA Sequence

MGLLAFLKTQFVLHLLVGFVFVVSGLVINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSC      1 - 70
TECTLFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLE     71 - 140
IVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKG    141 - 210
FTTAVKCLRGTVAAVYDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFPLEDIPLDEKEAAQWLHKLYQE    211 - 280
KDALQEIYNQKGMFPGEQFKPARRPWTLLNFLSWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASF    281 - 350
GVRRLIGVTEIEKGSSYGNQEFKKKE                                                351 - 376
//

Text Mined References (18)

PMID Year Title