Property Summary

NCBI Gene PubMed Count 325
PubMed Score 694.12
PubTator Score 921.50

Knowledge Summary

Patent (8,190)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Essential Hypertension 82 0.0 2.0
Lipid storage disease 7 0.0 1.0

Expression

  Differential Expression (26)

Disease log2 FC p
pancreatic cancer -2.200 4.5e-03
interstitial lung disease -1.700 4.8e-02
astrocytic glioma -3.500 2.5e-03
posterior fossa group B ependymoma -4.600 4.3e-14
oligodendroglioma -2.600 1.0e-02
glioblastoma -2.300 3.2e-02
osteosarcoma -2.658 5.7e-05
group 3 medulloblastoma -5.100 6.6e-05
atypical teratoid / rhabdoid tumor -4.900 5.5e-10
medulloblastoma, large-cell -3.700 1.8e-02
primitive neuroectodermal tumor -4.500 3.2e-05
Atopic dermatitis -1.600 5.2e-04
tuberculosis and treatment for 6 months 1.500 3.8e-03
non-small cell lung cancer -3.754 8.2e-27
active Crohn's disease -1.366 2.5e-02
interstitial cystitis -2.900 1.6e-05
adult high grade glioma -2.200 9.1e-03
pilocytic astrocytoma -2.700 1.2e-04
pancreatic carcinoma -2.200 4.5e-03
lung adenocarcinoma -1.300 1.5e-15
psoriasis -1.500 2.8e-37
lung carcinoma -1.100 1.4e-08
ductal carcinoma in situ -3.400 3.9e-03
invasive ductal carcinoma -4.300 1.2e-04
chronic rhinosinusitis -1.984 3.3e-02
head and neck cancer and chronic obstruc... -1.300 1.1e-03

 GWAS Trait (1)

MLP Assay (24)

AID Type Active / Inconclusive / Inactive Description
1788 other 0 / 0 / 0 Discovery of novel allosteric modulators of the M1 muscarinic receptor: Agonist Ancillary Activity
1921 other 2 / 0 / 0 Discovery of a Highly Selective in vitro and in vivo M4 Positive Allosteric Modulator: Ancillary Activity
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
540351 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P3 agonists: Ricerca HitProfilingScreen + CYP450
More...

Gene RIF (354)

PMID Text
26313487 In healthy individuals, heart rate and renin responses to dobutamine were more than three-fold greater among ADRB1 Arg389 compared with Gly389 homozygotes.
26248277 Suggest a common regulatory pattern for the beta(1)-AR/GRK5 which is independent of cellular type or pathology.
26125791 the b1 adrenergic receptor gene Arg389Gly polymorphism might not be associated with heart failure risk
26058836 ADRB1 is associated with heart rate recovery after exercise.
25837585 negative cooperativity across a beta1-adrenoceptor homodimer may be responsible for generating the low-affinity pharmacology of the secondary beta1-adrenoceptor conformation
25823457 There was no significant interaction between the effects of ADRB1 and CYP2D6 gene polymorphisms on treatment outcome. Patients homozygous for the mutant ADRB1 genotype (CC) had better treatment outcomes than those heterozygous for the mutation (GC).
25815601 This evidence, in combination with clinical studies, may contribute to a detailed analysis of the pattern of susceptibility to CVD involved in b-ADR1 receptor mechanism failure.
25673629 beta2-Stimulation is, therefore, more arrhythmogenic than beta1-stimulation in heart failure.
25638254 This study sought to identify the distributed characteristics of these variant genotypes in Chinese population, and influence of GRK5 and ADRB1 polymorphisms on systolic heart failure morbidity.
25614626 Our data suggest that PIST contributes to the fine-tuning of b1AR sorting both during biosynthetic and postendocytic trafficking
25558679 There is a direct correlation between Heart Rate and Systolic blood pressure in hypertensive patients with overweight and obesity from polymorphism Arg389Gly of ADRbeta1 gene.
25510377 Ser49Gly polymorphism of the ADRB1 gene confer higher risk of ischemic stroke in a North Indian population.
25451930 differences in interhelical interaction regulate the different activation speed and efficacy of ADRB1 variants
25406899 Adrenergic receptor genotype influences heart failure severity and beta-blocker response in children with dilated cardiomyopathy.
25351416 Higher serum anti-M2-R and anti-beta1-R levels are associated with lone paroxysmal atrial fibrillation.
25172623 In women with mitral valve prolapse syndrome, symptoms at least partially may be related to beta1-adrenergic receptor polymorphism, which has been shown previously to be associated with a hyperresponse to adrenergic stimulation.
25091480 Co-expression of COX2 and beta1AR lowers the expression of COX2 in a dose-dependent manner. Stimulation of the receptor does not reverse the beta1AR-induced decrease in COX2, suggesting that this effect does not occur via classical beta1-signaling pathways.
24982877 The possible link between beta 1-AR Gly389Arg and Ser49Gly polymorphisms and echocardiography parameters in 165 normotensive patients with a thyrotoxicosis without any cardiovascular disorders, was investigated.
24972470 The variant Arg389Gly of ADRB1 was statistically associated with an increase of LDL
24885710 beta1 and beta3-adrenergic receptors were expressed in retinal endothelial cells while beta2-adrenergic receptor was not detectable both at protein and mRNA levels.
24749907 Arg389 polymorphism of the ADRB1 gene and Gln27 polymorphism of the ADRB2 gene were associated with the hypotensive response to topic betaxolol in healthy Mexican volunteers.
24713698 Data indicate mutation of the beta1 adrenergic receptor (beta1AR) promotes sustained agonist-induced cAMP activity, protein kinase A (PKA) phosphorylation, and cardiac myocyte contraction response.
24552127 The beta1 -AR Arg389/Gly polymorphism may be associated with increased risk of orthostatic hypotension in female hypertensive patients.
24466231 High Beta1 adrenergic receptor expression is associated with peripartum cardiomyopathy.
24437165 AJ45G polymorphism (Ser49Gly) at DNA sites encoding for the amino acid sequence of beta1- adrenoreceptors can influence the development of sex-specific cardiac rhythm disorders.
24371822 The Arg389Gly polymorphism of the ADRB1 gene may be a worthy biological marker to predict the risk of developing cardiovascular diseases given a high-risk atherogenic index
24342311 Data did not support a relationship between the three polymorphisms of ADRB1 (rs1801253) and ADRB2 (rs1042713 and rs1042714) genes and risk of subsequent cardiovascular events after PCI in Han Chinese patients with CAD.
24334028 Our findings indicate a novel function for beta1AR-mediated beta-arrestin1 signaling activated by carvedilol in miR biogenesis.
24332148 The Gly389 variant in the beta1-adrenoreceptor is associated with postoperative atrial fibrillation.
24324269 the nature of the residue at position -3 in the PDZ regulated whether the beta1-AR was internalized alone or in complex with SAP97.
24159564 Bucindolol prevented new-onset AF; beta and alpha(2c) polymorphisms predicted therapeutic response; and the 47% of patients who were beta389 Arg homozygotes had an enhanced effect size of 74%.
24151242 S49G and R389G polymorphisms of the beta-adrenergic receptor influence signaling via the cAMP-PKA and ERK pathways.
24121510 a significant role for the AKAP5 scaffold in signaling and trafficking of the beta1-AR in cardiac myocytes and mammalian cells.
23729404 ADRB1 genetic polymorphisms did not influence left ventricular reverse remodeling after cardiac resynchronization therapy.
23588958 The Gly allele of ADRB1 Arg389Gly polymorphism might confer lower risk for essential hypertension, especially in East Asians.
23533220 Up-regulation of beta1AR action was eliminated with 17beta-estradiol addition to the media, directly implicating this hormone as a regulator of beta1AR expression.
23370410 Report distinctions between infantile hemangioma and vascular malformations with regard to ADRB1 mRNA levels.
23351074 We determined that in addition to uncoupling of the b1-AR from Gs, the A159E/I160R b1-AR did not phosphorylate ERK1/2.
23318885 beta-adrenoceptors are upregulated in human melanoma and their activation releases pro-tumorigenic cytokines and metalloproteases in melanoma cell lines.
23275278 Bucindolol prevents ventricular arrhythmias in subjects with heart failure and reduced left ventricular ejection fractions, and this effect is modulated by adrenergic beta(1) receptor polymorphisms.
23271137 These results provide clarification to the logical candidacy of beta1-adrenoreceptor gene in the development of hypertension.
23266473 beta1AR regulates the cAMP-binding protein Epac1 and consequently the activation of its downstream effectors Rap1 and Rap2B/Ras.
23261005 the selected SNPs of beta(1)-AR and beta(2)-AR genes influence HR response to metoprolol in patients who undergo coronary computed tomographic angiography.
23257656 results suggest that SNPs in the ADRB1 gene are associated with individual differences in pain and analgesic sensitivity
23223178 389-Arg/Arg patients with heart failure and atrial fibrillation had nominally significant reductions in all-cause mortality/HF hospitalization and cardiovascular mortality/hospitalization with bucindolol, whereas Gly carriers did not.
23115322 There was a gene-dose interaction with the ADRbeta1-389 Arg/Arg vs. Gly carrier genotype and beta-blocker dose in heart failure patients. Arg/Arg genotype patients may need a higher dose to achieve a treatment response similar to that of Gly carriers.
23114278 The early effect of esmolol on exercise-induced tachycardia was significantly greater among Arg389 than in Gly389 homozygote healthy individuals.
23065660 Data suggest that ADRB1 Arg389Gly polymorphism may influence exercise tolerance in heart failure patients.
23060133 PCR revealed that chronic atrial fibrillation up-regulated beta1-Adrenoceptor expression
22994654 Beta1-adrenergic receptor polymorphisms are associated with cardiac dysfunction after brain death.
22815685 impact of beta1-AR polymorphisms on susceptibility to heart failure, the response to beta-blocker therapy and the prognosis
22811559 Data indicate that disease-relevant beta1-adrenergic receptor (beta1-AR) autoantibodies in dilated cardiomyopathy (DCM) patient sera yielding a high reproducibility also in high throughput screening.
22742717 beta-receptor gene variants significantly influence inotropic and chronotropic responses to beta-agonist exposure in patients on beta-blocker therapy.
22723743 Through alpha(B)-D receptor heteromers dopamine inhibits adrenergic receptor signaling and blocks the synthesis of melatonin induced by adrenergic receptor ligands.
22703382 genetic association studies in a population in Denmark: Data suggest that an SNP in ADRB1 (rs1801253) is associated with plasma renin activity (PRA) and PRA response to exercise or metoprolol (i.e., resistance to adrenergic beta-1 receptor blocker).
22617224 The heart rate-lowering effects of carvedilol in patients with heart failure plus atrial fibrillation are modulated by the Arg389Gly polymorphism of the beta1-adrenoceptor.
22495925 Prediction of radiographic severity in Ankolysing Spondylitis based on clinical variables can be significantly improved by including SNPs at ADRB1 (rs1801253), NELL1 (rs8176785) and MHC (rs1634747, rs9270986, rs7451962 and rs241453) genes.
22447021 Positivity for ADRB1 autoantibody predicts abnormal histological findings in 90% of idiopathic arrhythmia patients and suggests that autoimmunity might play an arrhythmogenic role.
22378779 the TGN acts as a checkpoint for both the recycling and down-regulation of beta1AR and arrestin-3 not only mediates beta1AR endocytosis but also its recycling through the TGN
22340652 The Arg389Gly Arg/Arg genotype carriers are associated with an elevated risk of essential hypertension.
22306453 beta-1 and beta-3 adrenergic receptors were expressed in an orthotopic mouse model of transduced Nalm-6 huma pre-B ALL cells
22299391 This study showed for the first time an association between takotsubo cardiomyopathy phenotype and beta1 adrenoreceptor gene polymorphisms.
22253823 Nicotine-treated non-small cell lung cancer cells showed significant induction of the alpha7nAChR and alpha4nAChR, along with significant inductions of p-CREB and p-ERK1/2.
22192668 We have identified a common beta1-AR polymorphism, G389R, that is associated with adequate response to rate-control therapy in Atrial Fibrillation patients.
21878665 In human multipotent adipose-derived stem cells differentiated into functional brown adipocytes, activation of either beta(1)-adrenergic receptors or beta(3)-adrenergic receptors was able to increase UCP1 mRNA and protein levels.
21847570 Late positive potential amplitude depends on allelic variation in the beta1-receptor gene polymorphism.
21807569 ADRB1 gene variation appears to impact stroke index and plasma norepinephrine levels but not heart rate.
21626217 explores the relationship between LV remodeling after myocardial infarction and polymorphisms in the cardiac beta1-AR and beta2-AR genes
21599570 ADRB1 Gly49 was associated with higher baseline heart rates and with greater carvedilol effects on exercise heart rates.
21573230 Results provide evidence that beta(2)-AR polymorphisms are significantly associated with the acceleration/deceleration pattern of heart rate oscillation, reflecting the underlying mode of autonomic nervous system control.
21553224 Meta-analysis suggests no statistically significant association between beta1-adrenergic receptor gene polymorphisms and susceptibility to idiopathic dilated cardiomyopathy among Europeans.
21527343 In this experimental model of Down syndrome, selective activation of beta1-ADR restores cerain behavioral deficits in a transgenic mouse model.
21516734 There were associations of the polymorphism of ADRB1 gene (the Gly39Arg polymorphic locus) with the development and severity of CHF and with the efficacy of therapy with beta-adrenoblocker carvedilol.
21464135 Differential regulation of two palmitoylation sites in the cytoplasmic tail of the beta1-adrenergic receptor.
21422729 The results of the present study do not support clinical use of genotyping for these polymorphisms to predict responses to beta-blockers.
21375401 Haplotype structures of common variants of ADRB1 genes in a South Indian population
21311897 The responsiveness to beta-blockers with respect to cardiac contractility is determined by the Arg389Gly beta(1)AR gene polymorphism.
21305273 The ADRB1 1165C>G and 145A>G polymorphisms are not associated with the heart rate (HR), systolic (SBP) and diastolic (DBP) blood pressure responses in Polish Caucasian patients requiring diagnostic dobutamine stress echocardiography.
21238583 The heterodimerization of beta1-adrenergic receptor not only indicate the receptor's specificity of interaction but also provide new insight to understand the molecular mechanism in regulation of signaling pathway in receptor specific manner.
21059181 Observational study of gene-disease association. (HuGE Navigator)
21044781 Observational study of gene-disease association. (HuGE Navigator)
21034538 Observational study of gene-disease association. (HuGE Navigator)
20952631 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20948559 Observational study of gene-disease association. (HuGE Navigator)
20831043 Observational study of gene-disease association. (HuGE Navigator)
20821015 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20803192 Observational study of gene-disease association. (HuGE Navigator)
20731869 association between the beta1AR Arg389Gly polymorphism and left ventricular hypertrophy, particularly the septal hypertrophy
20731869 Observational study of gene-disease association. (HuGE Navigator)
20726983 investigation of whether activation of beta adrenoreceptors is involved in cardiac muscle contraction: activation of ADRB1 and ADBR2 is involved; activation of ADRB3 is not
20705341 Observational study of gene-disease association. (HuGE Navigator)
20693591 Observational study of gene-disease association. (HuGE Navigator)
20643254 Polymorphisms in ADRB1 were not associated with a response to metoprolol or carvedilol therapy in our cohort of patients with heart failure.The ADRB1 and CYP2D6 genotype, alone and in haplotype, were significantly associated with the dose of carvedilol.
20643254 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20625396 Observational study of gene-disease association. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20587416 N-terminal cleavage represents a novel regulatory mechanism of cell surface beta(1)ARs.
20581797 Report a significant interaction between ADRB1 Arg389Gly variant status and "beta-blocking" effect of selective serotonin reuptake inhibitors on heart rate and blood pressure.
20581797 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20538960 Observational study of gene-disease association. (HuGE Navigator)
20537417 Development of late hypertension after aortic coarctation repair could not be related to the investigated genomic polymorphism: the correlation of the ACE I/D and the ADRB1 c.1165C>G
20537417 Observational study of gene-disease association. (HuGE Navigator)
20470286 The beta1AR Arg389Gly polymorphism is not an independent predictor of cardiovascular events in subjects with overt diabetic nephropathy.
20470286 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20459474 Observational study of gene-disease association. (HuGE Navigator)
20443839 The role of beta-receptor selectivity for the interaction between the angiotensin-converting enzyme (ACE) insertion/deletion polymorphism and beta-blocker therapy was investigated in 479 subjects with left ventricular dysfunction.
20426789 Increased ADRB1 expression may account for some of the functional changes of hormone-sensitive lipase in patients with cancer cachexia.
20414837 [review] functionally active autoantibodies directed against the cardiac beta1-adrenergic receptor have been assigned a pivotal role in the pathogenesis of immune cardiomyopathy
20384459 Heterozygous genotype (Ser49Gly) of ADRB1 gene can be considered as one of the genetic predictors for development of primary or secondary atrial fibrillation.
20384459 Observational study of gene-disease association. (HuGE Navigator)
20374546 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20352314 Beta1-AR Arg389Gly and beta2-AR Arg16Gly SNPs are not related to the response to carvedilol therapy. The beta2-AR Gln27Glu SNP is a determinant of the left ventricular ejection fraction response to this agent in patients with chronic heart failure.
20352314 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20300048 genetic variation of beta1- and beta2-adrenergic receptor has a role in response to four classes of antihypertensive treatment
20300048 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20235788 In 1112 never-treated essential hypertension patients and 203 normotensive controls, tightly linked SNPs of beta-adrenergic receptors ADRB1, ADRB2 and the G-protein beta3-subunit GNB3 were genotyped.
20235788 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20203292 ADRB1 was overexpressed in bronchi of cystic fibrosis patients.
20185488 Genetic polymorphisms of the adrenergic system (the combination of beta(1)-Gly389Arg and GNB3 C825T) may help to identify heart failure patients who are more likely to receive appropriate implantable cardioverter-defibrillators therapies.
20185488 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20144152 increase of LV myocardial mass turned out age of patients, level of systolic arterial pressure, presence of excessive body mass and carriage of Arg/Arg genotype of polymorphic marker Gly389Arg of ADRB1 gene.
20144152 Observational study of gene-disease association. (HuGE Navigator)
20129829 No association of the polmorphisms Arg492Cys (ADRA1A gene), Ser49Gly and Arg389Gly (ADRB1), Arg16Gly and Gln27Glu (ADRB2), 825C/T (GNB3), -1021C/T (DBH) and S/L (SLC6A4) with both tilt test outcomes and new syncopal episodes was found
20123316 In a Chinese cohort, carriers of a genetic variant of beta-1 adrenergic receptor are found to be more susceptible to idiopathic dilated cardiomyopathy.
20116105 These results demonstrate a unique synergistic pro-inflammatory response mediated through a beta(1)-AR cyclic AMP-dependent mechanism in lipopolysaccharide-challenged monocytic cells.
20079238 The Gly389Arg CC genotype of beta(1)-adrenoceptor genes may be involved in cardiovascular complication in obstructive sleep apnea-hypopnea syndrome.
20079238 Observational study of gene-disease association. (HuGE Navigator)
20044737 Meta-analysis of gene-disease association. (HuGE Navigator)
20023040 The prevalence of polymorphisms of b1AR, b2AR, and GNAS were similar between patients and controls.
20023040 Observational study of gene-disease association. (HuGE Navigator)
19956635 Uncategorized study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19883298 Addition of 6 thermostabilizing mutations into both hbeta(2)AR and hbeta(2)AR increased their apparent T(m)s by 17 degrees C and 11 degrees C, respectively; the mutations affected the global conformation to the predominantly antagonist bound form
19845516 Heterozygous variant of Ser49gly of beta-adrenoreceptor gene was significantly more often met in patients with SSNS and their healthy relatives than in subjects of control group.
19842931 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19779464 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19745105 Observational study of gene-disease association. (HuGE Navigator)
19743955 The polymorphisms of the ADRB1 gene were associated with essential hypertension.
19743955 Observational study of gene-disease association. (HuGE Navigator)
19673943 Marked interethnic difference exist in beta(1)-adrenoceptor gene polymorphisms.
19673943 Observational study of gene-disease association. (HuGE Navigator)
19628119 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19623647 The Arg389 allele of the ADRB1 gene was associated with an elevated risk of myocardial infarction.
19623647 Observational study of gene-disease association. (HuGE Navigator)
19621046 sorbents on the basis of the conformational antigens (ADRB1) were more effective in comparison with those containing linear peptide precursors.
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19576569 Study addressed the recent evolutionary history of ADRB genes in human populations and found that ADRB1 is neutrally evolving.
19553224 Observational study of gene-disease association. (HuGE Navigator)
19542315 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19538012 Collectively, the promoting action of chloroform-extract from cigarette smoke on esophageal squamous-cell carcinoma cell proliferation is beta-adrenoceptor- and COX-2-dependent.
19515093 Results indicate that homodimerization of the alpha1-adrenoceptor occurs early during biosynthesis and that chaperones can promote dimerization and cell surface targeting, most likely by stabilizing conformations compatible with the two processes.
19509284 Beta-arrestin is required for the maintenance of a beta1-Adrenergic receptor -epidermal growth factor receptor interaction that can direct cytosolic targeting of extracellular regulated kinase in response to catecholamine stimulation.
19477404 The alpha(2C) Del322-325 polymorphism exclusively or in combination with the beta(1)Arg389 allele is not associated with an increased risk of adverse events in HF.
19378229 There was no significant difference in relation to genotype distribution and allele frequencies of any analysed b1-AR and b2-AR polymorphisms between IDCM patients and controls.
19378229 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19301767 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19167638 Genotype polymorphism frequencies for B1 receptor (amino acid positions 389 and 49) and alpha 2c receptor (deletion 322-325) are not significantly different in SC patients compared to female controls.
19094446 Knowledge of the combination of CYP2D6 and beta(1) adrenoreceptor polymorphisms may be used to guide antihypertensive therapy using beta(1) adrenoreceptor antagonists.
19094446 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
19073901 Normotensive sodium loading in normal man: regulation of renin secretion during beta1-receptor blockade.
19056576 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19037712 Beta1AR-mediated ERK activity involves the Galphas subunit, but not EGFR or Src tyrosine kinase.
19036891 The effects of aerobic fitness and beta1-adrenergic receptor blockade on cardiac work during dynamic exercise.
19033826 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19010176 significant correlation between beta1-AR and G-protein-coupled receptor kinases expression in heart failure heart transplantation patients.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18947427 Three polymorphisms in ADRA2C and five polymorphisms in ADRB1 were involved in eight cross-validated epistatic interactions identifying several two-locus genotype classes with significant relative risks of death/transplant in heart failure patients
18947427 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18937294 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18936436 Observational study of genotype prevalence. (HuGE Navigator)
18797399 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18794726 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18776959 Beta1- and alpha2c-adrenoreceptor variants as predictors of clinical aspects of dilated cardiomyopathy in people of African ancestry.
18776959 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18773997 The impact of beta1-adrenergic receptor polymorphisms on HF susceptibility, arrhythmogenesis, and prognosis. Polymorphisms had no influence on HF susceptibility. Gly389 allele was associated with lower prevalence of ventricular arrhythmias
18773997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18772317 catecholamines and isoproterenol stabilize distinct conformations in the beta(1)AR and beta(2)AR
18754404 results suggest that vasovagal syncope has a genetic component associated with the Arg389Gly polymorphism of the adrenergic receptor.
18754404 Observational study of gene-disease association. (HuGE Navigator)
18702968 Genotype and haplotype of ADRB1 did not significantly affect survival of metoprolol-treated or carvedilol-treated heart failure patients.
18702937 Observational study of gene-disease association. (HuGE Navigator)
18679149 Among patients admitted to the PICU with a meningococcal infection, those with the variant allele of the beta-adrenergic receptor gene-1 at locus 389 were more likely to have a high pediatric risk of mortality score on admission
18679149 Observational study of gene-disease association. (HuGE Navigator)
18625943 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18622236 Men with job strain and the Arg389Arg polymorphism were more often on antihypertensive treatment than other men
18622236 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18615004 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18596718 significant association of the ADRB1 arg389gly polymorphism with blood pressure and HDL cholesterol
18596718 Observational study of gene-disease association. (HuGE Navigator)
18540901 Beta1Gly49 homozygosity may increase the risk of developing transient tachypnea in the newborn.
18540901 Observational study of gene-disease association. (HuGE Navigator)
18534365 No association found between single nucleotide polymorphisms in the beta 1 adrenergic receptor and the risk of sudden cardiac death.
18534365 Observational study of gene-disease association. (HuGE Navigator)
18479335 Observational study of gene-disease association. (HuGE Navigator)
18452871 Observational study of gene-disease association. (HuGE Navigator)
18429752 No significant differences were revealed in dynamics of systolic and diastolic BP both at rest and at effort between patients with different genotypes of polymorphic marker Gly389Arg of ADRB1 gene.
18429752 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18413560 The relationship between hemodynamic response to mental stress and mental stress-induced myocardial ischemia (MSIMI) and 5 common functional polymorphisms of beta1-adrenergic receptors (ADRB1) and beta2-adrenergic receptors (ADRB2) was investigated.
18413560 Observational study of gene-disease association. (HuGE Navigator)
18413308 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18403719 Conformational rearrangements and signaling cascades involved in ligand-biased mitogen-activated protein kinase signaling through ADRB1.
18346809 Genetic variations of ADRB1 in relationship to morbid obesity and suggests mutations in the BAR-1 coding sequence is not likely a major cause of morbid obesity at least in Japanese.
18346809 Observational study of gene-disease association. (HuGE Navigator)
18331634 Observational study of gene-disease association. (HuGE Navigator)
18323523 The action of certain adrenergic beta 1 receptor blockers in the brain could contribute to their beneficial effect on the failing heart.
18311486 These results confirm the presence of beta1-, beta2-, and beta3-adrenoceptors in human urinary bladder urothelium; they suggest that urothelial beta-adrenoceptors induce the release of a urothelium-derived factor muscle
18308161 Observational study of gene-disease association. (HuGE Navigator)
18298953 Arg389Gly polymorphism of the ADRB1 gene confers higher risk of left ventricular hypertrophy in human essential hypertension.
18298953 Observational study of gene-disease association. (HuGE Navigator)
18253135 Observational study of gene-disease association. (HuGE Navigator)
18239290 Observational study of gene-disease association. (HuGE Navigator)
18219297 Genetic variants in the beta1-AR gene may determine whether to use beta-blockers in hypertension for the primary prevention of cardiovascular disease.
18219297 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18209576 the beta1AR gene is highly polymorphic and is commonly found in six haplotypic forms in the population; receptor expression varies by haplotype
18209576 Observational study of genotype prevalence. (HuGE Navigator)
18193079 In cardiomyocytes derived from embryonic stem cells, beta(1)- and beta(2)-adrenoceptors contributed to contractile responses.
18158268 Meta-analysis of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18155231 Endoplasmic reticulum stress plays an important role in cell death and cardiac dysfunction in beta(1)-extracellular loop (EC)(II) IgG cardiomyopathy, and the effects of beta(1)-EC(II) IgG are mediated via the beta(1)-adrenergic receptor.
18075464 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18075464 Polymorphosm in beta1-adrenergic receptors determine improvement in left ventricular systolic function in nonischemic cardiomyopathy patients with heart failure after chronic treatment with carvedilol
18059082 Observational study of gene-disease association. (HuGE Navigator)
18059082 Polymorphisms in ADRB1 and UCP3 may contribute to insulin resistance rather than obesity among Swedish women.
17998459 human betaARs undergo a process of intracellular sequestration that is dynamically reversed after LVAD support. Importantly, mechanical unloading leads to complete reversal in PI3Kgamma and betaARK1-associated PI3K activation.
17919552 Milrinone potentiated contractile response to beta 1 and beta 2 adrenergic receptor agonists.
17893006 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17845930 Observational study of gene-disease association. (HuGE Navigator)
17845930 heart transplant patients with the beta1-AR Gly49 variants had a lower heart rate, and better stress endurance and diastolic function compared with patients homozygous for Ser49; they also showed a trend toward better chronotropic reserve
17680533 The 389A/G polymorphism in the human beta 1-adrenergic receptor is associated with acute myocardial infarction and is an independent risk factor of AMI.
17680533 Observational study of gene-disease association. (HuGE Navigator)
17667029 ADRB1/2 genotype is independently associated with the dilated cardiomyopathy phenotype, suggesting their role in favouring susceptibility to the disease.
17644825 Meta-analysis and HuGE review of gene-disease association. (HuGE Navigator)
17635183 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17591269 Observational study of gene-disease association. (HuGE Navigator)
17585213 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17541557 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17512307 Observational study of gene-disease association. (HuGE Navigator)
17496726 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17463065 Observational study of gene-disease association. (HuGE Navigator)
17463065 An association of positive tilt table testing to a single nucleotide polymorphism with a Gly to Arg switch at position 389 of the beta(1)AR was found.
17383306 Observational study of gene-disease association. (HuGE Navigator)
17345787 Observational study of gene-disease association. (HuGE Navigator)
17345787 Pulse wave velocity and nitroglycerin-induced hyperemia were both closely associated with the Ser49Gly polymorphism.
17339538 Observational study of gene-disease association. (HuGE Navigator)
17335470 Observational study of gene-disease association. (HuGE Navigator)
17335470 results suggest that the Arg389Gly polymorphism does not have any clinically important impact on the pathogenesis of obesity in Danish white subjects; this variant is most likely not to be a major contributor to the development of hypertension
17334644 Observational study of gene-disease association. (HuGE Navigator)
17329986 Genetic polymorphisms in the B1AR gene have the potential to explain some of the observed ethnic variability in drug response and to improve clinical practice (Review)
17270896 Observational study of gene-disease association. (HuGE Navigator)
17223428 Observational study of gene-disease association. (HuGE Navigator)
17217681 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17118120 Golgin-160 interacts with beta1AR
17023080 Observational study of gene-disease association. (HuGE Navigator)
17023080 In this relatively small study, double homozygosity for Arg389 and Ser49 of the human beta1-adrenergic receptor associated with the risk of symptoms in LQT1.
16997396 Our results suggest that CRM 1-dependent NES-mediated mechanisms influence the degradation and agonist-mediated down-regulation of the beta1-AR mRNAs.
16946993 Observational study of gene-disease association. (HuGE Navigator)
16940053 AKAP79 provides cyclic AMP-dependent protein kinase to phosphorylate the beta1-adrenergic receptor and thereby dictate the recycling and resensitization itineraries of the beta1-adrenergic receptor
16914520 These results suggest that the dynamic association of 14-3-3 proteins to both beta(1)AR and Kv11.1 channels is involved in the adrenergic modulation of this critical regulator of cardiac repolarization and refractoriness.
16907703 Observational study of gene-disease association. (HuGE Navigator)
16844790 beta(1)AR-389 variation alters signaling in multiple models and affects the beta-blocker therapeutic response in heart failure
16815314 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16785856 Observational study of gene-disease association. (HuGE Navigator)
16785856 Certain polymorphisms of the ADRB1 and ADRB2 genes influence the pathophysiology of open-angle glaucoma in Japanese patients.
16765375 beta1-adrenergic receptors are upregulated and troponin I is dephosphorylated in end-stage heart failure patients supported by ventricular assist devices
16760361 These findings indicate that Lys324 lies in a groove between helices 3 and 6, and its mutagenesis generates a mutant receptor with very low binding affinity for the GDP-bound isoform of G(s).
16728691 Observational study of gene-disease association. (HuGE Navigator)
16728691 Homozygousbeta1AR Arg389Gly predicts cardiac troponin release in subarachnoid hemorrhage. Combining homozygous B1AR Arg389Gly & homozygous deletion of B2AR increases the odds of reduced left ventricular ejection fraction.
16648137 Val-120, Ile-185, Asp-212, and Lys-253 are critically involved in conformational changes occurring during receptor activation
16534528 Observational study of gene-disease association. (HuGE Navigator)
16500896 the amphipathic character of helix 8 and side chain projections of Asp382 and Arg384 within the hydrophilic interface might serve as a tethering site for the G protein
16487965 Observational study of gene-disease association. (HuGE Navigator)
16485781 Observational study of genotype prevalence. (HuGE Navigator)
16421173 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16402084 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16325708 Observational study of gene-disease association. (HuGE Navigator)
16325708 In this small pilot series, a single nucleotide polymorphism at codon 389 in the beta1-AR seems to correlate with a response to betaxolol therapy in normal, nonglaucomatous volunteers.
16315032 Clinical trial of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16287427 Observational study of gene-disease association. (HuGE Navigator)
16227135 Observational study of gene-disease association. (HuGE Navigator)
16210433 Observational study of gene-disease association. (HuGE Navigator)
16189366 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16187973 Observational study of gene-disease association. (HuGE Navigator)
16153393 Observational study of gene-disease association. (HuGE Navigator)
16122377 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15932670 Beta(1)-adrenergic receptor mRNA expressions in myocardium were significantly lower in patients with heart failure than those in control subjects.
15917856 Observational study of gene-disease association. (HuGE Navigator)
15864115 Observational study of gene-disease association. (HuGE Navigator)
15864115 the Arg389Arg and Ser49Gly polymorphisms may have roles in left ventricular remodeling changes in response to beta-blocker therapy
15861037 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15861037 beta1AR or the beta2AR polymorphisms do not affect patient response to beta-blockade treatment for stable congestive heart failure
15833937 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15833937 evidence for an interaction between the beta1- and beta2-adrenergic receptors was observed in men for longitudinal change in body mass index and women showed suggestive evidence for an interaction between the beta1- and beta3-adrenergic receptors
15824464 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15735607 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15719258 Observational study of gene-disease association. (HuGE Navigator)
15685248 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15564877 Observational study of gene-disease association. (HuGE Navigator)
15542284 Observational study of gene-disease association. (HuGE Navigator)
15479221 Observational study of gene-disease association. (HuGE Navigator)
15464701 Observational study of gene-disease association. (HuGE Navigator)
15388645 Substitution of the C-terminal cytoplasmic tail of the beta2-adrenergic receptor on the beta1-adrenergic receptor enabled the chimeric G protein-coupled receptor to be functionally and spatially regulated by insulin.
15342173 Observational study of gene-disease association. (HuGE Navigator)
15331590 the lack of agonist-mediated ubiquitination of beta1AR may prevent its extensive trafficking to lysosomes
15312808 Observational study of gene-disease association. (HuGE Navigator)
15312808 The Ser49Gly functional polymorphism in the beta(1) adrenergic receptor might explain some of the population variance in extraversion and related personality traits.
15237695 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15212839 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15212839 Single-nucleotide polymorphisms (SNPs) in the beta1-adrenergic receptor (ADRB1) allelic frequencies were analyzed in Alzheimer's disease. The combination of G protein beta3 subunit and ADRB1 polymorphisms produces AD susceptibility.
15212591 Observational study of genotype prevalence. (HuGE Navigator)
15079793 Observational study of gene-disease association. (HuGE Navigator)
15055253 Observational study of gene-disease association. (HuGE Navigator)
15055253 The ADRB1/R389G polymorphism tended to be associated with hypertensive status in male subjects (p=0.0117, p(c)=0.0702).
14990580 PKA-mediated phosphorylation of G protein-coupled receptors might result in motif-dependent desensitization or resensitization.
14734649 internalization of beta(1)AR is both arrestin- and dynamin-dependent and follows the same clathrin-mediated endocytic pathway as beta(2)AR
14553962 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14534524 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14502278 Data show that the beta(1)-adrenergic receptor Arg389 variant predisposes to heart failure through hyperactive signaling programs, depressed receptor coupling and ventricular dysfunction, and influences the therapeutic response to beta-receptor blockade.
12921807 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12851615 Observational study of gene-disease association. (HuGE Navigator)
12847069 The partial agonist activity of bucindolol is dependent on the activation state of the human beta-1 adrenergic receptor
12844134 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12815745 Observational study of gene-disease association. (HuGE Navigator)
12815745 An association was not found between B1AR polymorphism and major depression, but there was a tendency for a relation between CC homozygosity and a better and even faster response to antidepressant treatment in patients with major depression.
12709726 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12643891 Observational study of gene-disease association. (HuGE Navigator)
12544508 Observational study of gene-environment interaction. (HuGE Navigator)
12529373 An interaction between beta(1)AR and alpha(2A)AR is regulated by glycosylation and may play a key role in cross-talk and mutual regulation between these receptors.
12519093 Observational study of gene-environment interaction. (HuGE Navigator)
12455717 Observational study of gene-disease association. (HuGE Navigator)
12422153 Observational study of gene-disease association. (HuGE Navigator)
12391161 These results suggest a model whereby the physical interaction between the beta1-AR and CNrasGEF facilitates the transduction of Gsalpha-induced cAMP signal into the activation of Ras.
12374873 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12270132 Glycosylation regulates receptor surface expression and dimerization
12244098 Results indicate that the proportion of homo- and heterodimers between the closely related beta(1)- and beta(2)-adrenergic receptors is determined by their relative levels of expression.
12197595 Observational study of gene-disease association. (HuGE Navigator)
12197595 Suppressive effect of the Gly389 allele of the beta1-adrenergic receptor gene on the occurrence of ventricular tachycardia in dilated cardiomyopathy.
12140284 role of heterodimerization with beta 2-adrenergic receptor regulates beta 2-adrenergic receptor internalization and ERK signaling efficacy
12106601 beta1-adrenoceptor and beta2-adrenoceptor couple to Gs-proteins to activate adenylyl cyclase
12090746 Observational study of gene-disease association. (HuGE Navigator)
12069593 The agonist-specific component of beta1AR downregulation requires internalization correlating more closely with receptor degradation, while the cAMP-specific component does not require internalization and is associated with downregulation of beta1AR mRNA.
12032746 Observational study of gene-disease association. (HuGE Navigator)
12032746 Gly389Arg ADRB1 variant is associated with greater body weight and BMI in Caucasian women due to a greater fat mass
12029453 Observational study of gene-disease association. (HuGE Navigator)
12023679 Observational study of gene-disease association. (HuGE Navigator)
11942593 Observational study of gene-disease association. (HuGE Navigator)
11854867 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11854867 A polymorphism in the beta1 adrenergic receptor is associated with resting heart rate
11753577 Observational study of gene-disease association. (HuGE Navigator)
11447084 Observational study of gene-disease association. (HuGE Navigator)
11337934 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11140838 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11052857 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAGMGLLMALIVL      1 - 70
LIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVL     71 - 140
CVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFLPILMHWWRAESDEARRCY    141 - 210
NDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPV    211 - 280
PAPAPPPGPPRPAAAAATAPLANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFH    281 - 350
RELVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP    351 - 420
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV                 421 - 477
//

Text Mined References (326)

PMID Year Title
26313487 2015 Effects of sex and the common ADRB1 389 genetic polymorphism on the hemodynamic response to dobutamine.
26248277 2015 ?2- and ?1-Adrenoceptor Expression Exhibits a Common Regulatory Pattern With GRK2 and GRK5 in Human and Animal Models of Cardiovascular Diseases.
26125791 2015 Association between ?1 adrenergic receptor gene Arg389Gly polymorphism and risk of heart failure: a meta-analysis.
26058836 2015 Genetic variation in alpha2-adrenoreceptors and heart rate recovery after exercise.
25837585 2015 Negative cooperativity across ?1-adrenoceptor homodimers provides insights into the nature of the secondary low-affinity CGP 12177 ?1-adrenoceptor binding conformation.
25823457 2015 Associations between ADRB1 and CYP2D6 gene polymorphisms and the response to ?-blocker therapy in hypertension.
25815601 2015 Ser49Gly polymorphism in the ?-adrenergic receptor 1 gene in a population sample from Rio de Janeiro state, Brazil, stratified by self-identified skin color and genetic ancestry.
25673629 2015 Arrhythmogenic remodeling of ?2 versus ?1 adrenergic signaling in the human failing heart.
25638254 2015 Effects of GRK5 and ADRB1 polymorphisms influence on systolic heart failure.
25614626 2015 The golgi-associated PDZ domain protein PIST/GOPC stabilizes the ?1-adrenergic receptor in intracellular compartments after internalization.
25558679 2014 [Genetic dependency of blood pressure and heart rate in patients with arterial hypertension and obesity].
25510377 2015 Association between beta-1 adrenergic receptor gene polymorphism and ischemic stroke in North Indian population: a case control study.
25451930 2015 Interhelical interaction and receptor phosphorylation regulate the activation kinetics of different human ?1-adrenoceptor variants.
25406899 2015 Adrenergic receptor genotype influences heart failure severity and ?-blocker response in children with dilated cardiomyopathy.
25351416 2015 Elevated M2-muscarinic and ?1-adrenergic receptor autoantibody levels are associated with paroxysmal atrial fibrillation.
25172623 2015 Floppy mitral valve/mitral valve prolapse syndrome: Beta-adrenergic receptor polymorphism may contribute to the pathogenesis of symptoms.
25091480 2014 ?1-Adrenergic receptor downregulates the expression of cyclooxygenase-2.
24982877 2014 Polymorphisms of ? 1-adrenoreceptor gene and cardiovascular complications in patients with thyrotoxicosis.
24972470 2014 Association of ?1 and ?3 adrenergic receptors gene polymorphisms with insulin resistance and high lipid profiles related to type 2 diabetes and metabolic syndrome.
24885710 2014 Differential expression and role of hyperglycemia induced oxidative stress in epigenetic regulation of ?1, ?2 and ?3-adrenergic receptors in retinal endothelial cells.
24749907 2014 ADRB1 and ADBR2 gene polymorphisms and the ocular hypotensive response to topical betaxolol in healthy Mexican subjects.
24713698 2014 A long lasting ?1 adrenergic receptor stimulation of cAMP/protein kinase A (PKA) signal in cardiac myocytes.
24552127 2014 Orthostatic blood pressure dysregulation and polymorphisms of ?-adrenergic receptor genes in hypertensive patients.
24466231 2014 The correlation between peripartum cardiomyopathy and autoantibodies against cardiovascular receptors.
24437165 2013 [Manifestations of polymorphism of ?1-adrenoreceptors in patients with newly diagnosed cardiac rhythm disorders].
24371822 2013 IRS1, TCF7L2, ADRB1, PPARG, and HHEX polymorphisms associated with atherogenic risk in Mexican population.
24342311 2013 Association of ?-adrenergic receptor genes polymorphisms with incidence of subsequent cardiovascular events in Han Chinese patients with coronary artery disease.
24334028 2014 ?-arrestin1-biased ?1-adrenergic receptor signaling regulates microRNA processing.
24332148 2014 Genetic variation in the ?1-adrenergic receptor is associated with the risk of atrial fibrillation after cardiac surgery.
24324269 2014 Sorting of ?1-adrenergic receptors is mediated by pathways that are either dependent on or independent of type I PDZ, protein kinase A (PKA), and SAP97.
24159564 2013 Prevention of atrial fibrillation by bucindolol is dependent on the beta?389 Arg/Gly adrenergic receptor polymorphism.
24151242 2013 S49G and R389G polymorphisms of the ??-adrenergic receptor influence signaling via the cAMP-PKA and ERK pathways.
24121510 2013 Role of AKAP79/150 protein in ?1-adrenergic receptor trafficking and signaling in mammalian cells.
23729404 2013 Adrenergic receptor gene polymorphism and left ventricular reverse remodelling after cardiac resynchronization therapy: preliminary results.
23588958 2013 ?1-adrenoceptor gene Arg389Gly polymorphism and essential hypertension risk in general population: a meta-analysis.
23533220 2013 Enhanced striatal ?1-adrenergic receptor expression following hormone loss in adulthood is programmed by both early sexual differentiation and puberty: a study of humans and rats.
23381222 2013 ?1-adrenergic receptor antagonists signal via PDE4 translocation.
23370410 2013 ?1-Adrenoceptor mRNA level reveals distinctions between infantile hemangioma and vascular malformations.
23351074 2013 The hydrophobic amino acid cluster at the cytoplasmic end of transmembrane helix III modulates the coupling of the ?(1)-adrenergic receptor to G(s).
23318885 2013 ?-adrenoceptors are upregulated in human melanoma and their activation releases pro-tumorigenic cytokines and metalloproteases in melanoma cell lines.
23275278 2013 Adrenergic receptor polymorphisms and prevention of ventricular arrhythmias with bucindolol in patients with chronic heart failure.
23271137 2013 The ?1-adrenoreceptor gene Arg389Gly and Ser49Gly polymorphisms and hypertension: a meta-analysis.
23266473 2013 Specific interactions between Epac1, ?-arrestin2 and PDE4D5 regulate ?-adrenergic receptor subtype differential effects on cardiac hypertrophic signaling.
23261005 2013 Impact of ?(1)- and ?(2)-adrenergic receptor gene single nucleotide polymorphisms on heart rate response to metoprolol prior to coronary computed tomographic angiography.
23257656 2013 Association between genetic polymorphisms of the ?1-adrenergic receptor and sensitivity to pain and fentanyl in patients undergoing painful cosmetic surgery.
23223178 2013 Effect of bucindolol on heart failure outcomes and heart rate response in patients with reduced ejection fraction heart failure and atrial fibrillation.
23202124 2013 New loci associated with birth weight identify genetic links between intrauterine growth and adult height and metabolism.
23115322 2013 Association between adrenergic receptor genotypes and beta-blocker dose in heart failure patients: analysis from the HF-ACTION DNA substudy.
23114278 2013 The common Arg389gly ADRB1 polymorphism affects heart rate response to the ultra-short-acting ?(1) adrenergic receptor antagonist esmolol in healthy individuals.
23065660 2013 GNAS A-1121G variant is associated with improved diastolic dysfunction in response to exercise training in heart failure patients.
23060133 2013 Chronic atrial fibrillation up-regulates ?1-Adrenoceptors affecting repolarizing currents and action potential duration.
22994654 2012 Beta-adrenergic receptor polymorphisms and cardiac graft function in potential organ donors.
22815685 2012 ?1 adrenergic receptor polymorphisms and heart failure: a meta-analysis on susceptibility, response to ?-blocker therapy and prognosis.
22811559 2012 Detection of anti-?1-AR autoantibodies in heart failure by a cell-based competition ELISA.
22742717 2012 Response to catecholamine stimulation of polymorphisms of the beta-1 and beta-2 adrenergic receptors.
22723743 2012 Circadian-related heteromerization of adrenergic and dopamine D? receptors modulates melatonin synthesis and release in the pineal gland.
22703382 2012 Effect of the Arg389Gly ??-adrenoceptor polymorphism on plasma renin activity and heart rate, and the genotype-dependent response to metoprolol treatment.
22617224 2012 Impact of the ?1-adrenoceptor Arg389Gly polymorphism on heart-rate responses to bisoprolol and carvedilol in heart-failure patients.
22495925 2012 Genetic polymorphisms inside and outside the MHC improve prediction of AS radiographic severity in addition to clinical variables.
22447021 2012 Anti-?-adrenoceptors autoimmunity causing 'idiopathic' arrhythmias and cardiomyopathy.
22388998 2012 Genome-wide association study of N370S homozygous Gaucher disease reveals the candidacy of CLN8 gene as a genetic modifier contributing to extreme phenotypic variation.
22378779 2012 Trans-Golgi Network (TGN) as a regulatory node for ?1-adrenergic receptor (?1AR) down-modulation and recycling.
22340652 2011 [Polymorphisms of Arg389Gly of ?1-adrenergic receptor gene and essential hypertension risk: a meta analysis].
22306453 2012 Chronic stress enhances progression of acute lymphoblastic leukemia via ?-adrenergic signaling.
22299391 2011 Analysis of beta1 and beta2-adrenergic receptors polymorphism in patients with apical ballooning cardiomyopathy.
22253823 2012 Cooperative regulation of non-small cell lung carcinoma by nicotinic and beta-adrenergic receptors: a novel target for intervention.
22192668 2012 A common ?1-adrenergic receptor polymorphism predicts favorable response to rate-control therapy in atrial fibrillation.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
21878665 2011 ??-Adrenergic receptors increase UCP1 in human MADS brown adipocytes and rescue cold-acclimated ??-adrenergic receptor-knockout mice via nonshivering thermogenesis.
21847570 2012 Beta receptor-mediated modulation of the late positive potential in humans.
21807569 2011 ?-1 and ?-2 adrenergic receptor polymorphism and association with cardiovascular response to orthostatic screening.
21626217 2011 Polymorphisms of the beta adrenergic receptor predict left ventricular remodeling following acute myocardial infarction.
21599570 2011 Carvedilol pharmacokinetics and pharmacodynamics in relation to CYP2D6 and ADRB pharmacogenetics.
21573230 2011 Clustering heart rate dynamics is associated with ?-adrenergic receptor polymorphisms: analysis by information-based similarity index.
21553224 2012 A meta-analysis of ?1-adrenergic receptor gene polymorphisms in idiopathic dilated cardiomyopathy.
21540189 2011 Down-modulation of the G-protein-coupled estrogen receptor, GPER, from the cell surface occurs via a trans-Golgi-proteasome pathway.
21527343 2011 Comprehensive behavioral phenotyping of Ts65Dn mouse model of Down syndrome: activation of ?1-adrenergic receptor by xamoterol as a potential cognitive enhancer.
21516734 2010 [Impact of Gly389Arg beta1-adrenoceptor polymorphism on the risk of chronic heart failure, the nature of its course, and on the efficiency of its treatment with carvedilol].
21464135 2011 Differential regulation of two palmitoylation sites in the cytoplasmic tail of the beta1-adrenergic receptor.
21422729 2011 ?(1)-Adrenergic receptor gene polymorphisms and the acute response to atenolol in healthy young Japanese subjects.
21375401 2011 Haplotype structures of common variants of CYP2C8, CYP2C9, and ADRB1 genes in a South Indian population.
21311897 2011 The Arg389Gly ?1-adrenoceptor gene polymorphism influences the acute effects of ?-adrenoceptor blockade on contractility in the human heart.
21305273 2011 Effect of the ADRB1 1165C>G and 145A>G polymorphisms on hemodynamic response during dobutamine stress echocardiography.
21238583 2011 Receptor specific crosstalk and modulation of signaling upon heterodimerization between ?1-adrenergic receptor and somatostatin receptor-5.
21059181 2011 Polymorphisms of adrenergic cardiovascular control genes are associated with adolescent chronic fatigue syndrome.
21044781 2011 Genetic variants of connexin37 are associated with carotid intima-medial thickness and future onset of ischemic stroke.
21034538 2010 Beta2-adrenoceptor gene variant Arg16Gly is associated with idiopathic ventricular outflow-tract tachycardia.
20952631 2010 Association of single-nucleotide polymorphisms from 17 candidate genes with baseline symptom-limited exercise test duration and decrease in duration over 20 years: the Coronary Artery Risk Development in Young Adults (CARDIA) fitness study.
20948559 2010 Polymorphisms in ?- and ?-Adrenergic Receptor Genes, Hypertension, and Obstructive Sleep Apnea: The Skaraborg Sleep Study.
20831043 2010 [Genetic predisposition to development of atrial fibrillation in patients with hypertensive disease].
20821015 2011 Functional effects of ??-adrenoceptor polymorphisms on the hemodynamic response to dobutamine with and without ?-blocker administration.
20803192 2010 The Arg16Gly-?(2)-adrenoceptor single nucleotide polymorphism: exercise capacity and survival in patients with end-stage heart failure.
20731869 2010 Association of the beta-1 adrenergic receptor carboxyl terminal variants with left ventricular hypertrophy among diabetic and non-diabetic survivors of acute myocardial infarction.
20726983 2011 Human atrial ?(1L)-adrenoceptor but not ??-adrenoceptor activation increases force and Ca(2+) current at physiological temperature.
20705341 2010 Association between genetic polymorphisms of adrenergic receptor and diurnal intraocular pressure in Japanese normal-tension glaucoma.
20693591 2010 Polymorphic variants of beta1 adrenergic receptor gene (Ser49Gly & Arg389Gly) in healthy Tamilian volunteers.
20643254 2010 Relation of ADRB1, CYP2D6, and UGT1A1 polymorphisms with dose of, and response to, carvedilol or metoprolol therapy in patients with chronic heart failure.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20625396 2010 Beta1-adrenoceptor polymorphism predicts flecainide action in patients with atrial fibrillation.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20587416 2010 Human beta1-adrenergic receptor is subject to constitutive and regulated N-terminal cleavage.
20581797 2010 A pilot study of the pharmacodynamic impact of SSRI drug selection and beta-1 receptor genotype (ADRB1) on cardiac vital signs in depressed patients: a novel pharmacogenetic approach.
20538960 2010 A candidate gene study of obstructive sleep apnea in European Americans and African Americans.
20537417 2011 Impact of genomic polymorphism on arterial hypertension after aortic coarctation repair.
20470286 2010 Relationship between beta1-adrenergic receptor polymorphisms and cardiovascular disease in patients with diabetic nephropathy.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20459474 2011 Can we predict top-level sports performance in power vs endurance events? A genetic approach.
20443839 2008 The beta1-adrenergic receptor mediates the pharmacogenetic interaction of the ACE D allele and beta-blockers.
20426789 2010 Role of beta1-adrenoceptor in increased lipolysis in cancer cachexia.
20414837 2010 Targeting receptor antibodies in immune cardiomyopathy.
20384459 2010 Association of ADRB1 gene polymorphism with atrial fibrillation.
20374546 2010 Beta-adrenergic receptor gene polymorphisms and cardiovascular reactivity to stress in Black adolescents and young adults.
20352314 2010 Role of beta-adrenergic receptor gene polymorphisms in the long-term effects of beta-blockade with carvedilol in patients with chronic heart failure.
20300048 2010 Common genetic variation of beta1- and beta2-adrenergic receptor and response to four classes of antihypertensive treatment.
20235788 2010 Haplotypes of the adrenergic system predict the blood pressure response to beta-blockers in women with essential hypertension.
20203292 2011 ?1, ?2, and ?3 adrenoceptors and Na+/H+ exchanger regulatory factor 1 expression in human bronchi and their modifications in cystic fibrosis.
20185488 2010 Genetic polymorphisms of the adrenergic system and implantable cardioverter-defibrillator therapies in patients with heart failure.
20144152 2010 [Myocardial hypertrophy in patients with hypertensive disease: the role of genetic polymorphism of beta-adrenoreactive structures].
20129829 2010 Lack of association between genetic polymorphisms affecting sympathetic activity and tilt-induced vasovagal syncope.
20123316 2010 Polymorphisms of beta-adrenoceptor and natriuretic peptide receptor genes influence the susceptibility to and the severity of idiopathic dilated cardiomyopathy in a Chinese cohort.
20116105 2010 Pro-inflammatory responses in human monocytes are beta1-adrenergic receptor subtype dependent.
20079238 2009 [The association between polymorphism of beta(1)-adrenoceptor genes and cardiovascular complication in obstructive sleep apnea-hypopnea syndrome patients in Han population].
20044737 2010 Synopsis and data synthesis of genetic association studies in hypertension for the adrenergic receptor family genes: the CUMAGAS-HYPERT database.
20023040 2010 L41Q polymorphism of the G protein coupled receptor kinase 5 is associated with left ventricular apical ballooning syndrome.
19956635 2009 Fulfilling the promise of personalized medicine? Systematic review and field synopsis of pharmacogenetic studies.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19883298 2009 Transferability of thermostabilizing mutations between beta-adrenergic receptors.
19845516 2009 [Ser49gly polymorphism as predictor of development of hereditary sick sinus node syndrome].
19842931 2009 GRK5 Gln41Leu polymorphism is not associated with sensitivity to beta(1)-adrenergic blockade in humans.
19779464 2009 Genetic factors are relevant and independent determinants of antihypertensive drug effects in a multiracial population.
19745105 2009 Adrenergic beta-1 receptor genetic variation predicts longitudinal rate of GFR decline in hypertensive nephrosclerosis.
19743955 2009 Polymorphisms of the beta1-adrenergic receptor gene are associated with essential hypertension in Chinese.
19673943 2009 Genetic variants of beta(1)-adrenoceptor gene polymorphisms (Ser49Gly and Arg389Gly) and essential hypertension in a south Indian Tamil population.
19628119 2009 Clinical and genetic modifiers of long-term survival in heart failure.
19623647 2009 Association of beta-1 and beta-2 adrenergic receptor gene polymorphisms with myocardial infarction.
19621046 [Synthesis and properties of a new conformational antigen modeling an extracellular region of beta(1)-adrenoreceptor].
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19576569 2009 Diverse evolutionary histories for beta-adrenoreceptor genes in humans.
19553224 2011 Trp64Arg polymorphism in ADRB3 gene is associated with elite endurance performance.
19542315 2009 Effect of 393T>C polymorphism of GNAS1 gene on dobutamine response in Chinese healthy subjects.
19538012 2009 Chloroform extract of cigarette smoke induces proliferation of human esophageal squamous-cell carcinoma cells: modulation by beta-adrenoceptors.
19515093 2009 Functional rescue of beta-adrenoceptor dimerization and trafficking by pharmacological chaperones.
19509284 2009 beta-Arrestin mediates beta1-adrenergic receptor-epidermal growth factor receptor interaction and downstream signaling.
19477404 2009 Polymorphisms of adrenoceptors are not associated with an increased risk of adverse event in heart failure: a MERIT-HF substudy.
19378229 2009 Polymorphisms of the beta-1 and beta-2 adrenergic receptors in Polish patients with idiopathic dilated cardiomyopathy.
19301767 2008 [Interactions between beta1 and beta2 adrenergic receptor polymorphisms as risk factors for chronic heart failure].
19167638 2009 Adrenergic receptor polymorphisms in patients with stress (tako-tsubo) cardiomyopathy.
19094446 Effects of polymorphism of the beta(1) adrenoreceptor and CYP2D6 on the therapeutic effects of metoprolol.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19073901 2009 Normotensive sodium loading in normal man: regulation of renin secretion during beta-receptor blockade.
19056576 2009 Effects of novel capsinoid treatment on fatness and energy metabolism in humans: possible pharmacogenetic implications.
19037712 2010 The beta1-adrenergic receptor mediates extracellular signal-regulated kinase activation via Galphas.
19036891 2009 The effects of aerobic fitness and beta1-adrenergic receptor blockade on cardiac work during dynamic exercise.
19033826 2008 Genetic polymorphisms of beta1 adrenergic receptor and their influence on the cardiovascular responses to metoprolol in a South Indian population.
19010176 2008 Correlation between beta-adrenoceptors and G-protein-coupled receptor kinases in pretransplantation heart failure.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18947427 2008 Multiple interactions between the alpha 2C- and beta1-adrenergic receptors influence heart failure survival.
18937294 2008 Genome-wide association scan of the time to onset of attention deficit hyperactivity disorder.
18936436 2009 Prevalence in the United States of selected candidate gene variants: Third National Health and Nutrition Examination Survey, 1991-1994.
18797399 2008 Variation in the genes encoding vesicular monoamine transporter 2 and beta-1 adrenergic receptor and antidepressant treatment outcome.
18794726 2008 Beta-1-adrenoceptor genetic variants and ethnicity independently affect response to beta-blockade.
18776959 Beta1- and alpha2c-adrenoreceptor variants as predictors of clinical aspects of dilated cardiomyopathy in people of African ancestry.
18773997 2008 Impact of beta1-adrenergic receptor polymorphisms on susceptibility to heart failure, arrhythmogenesis, prognosis, and response to beta-blocker therapy.
18772317 2008 Distinct interactions of human beta1- and beta2-adrenoceptors with isoproterenol, epinephrine, norepinephrine, and dopamine.
18754404 [Genetic study of the vasovagal syncope associated to the Arg389Gly polymorphism of the beta1 adrenergic receptor].
18702968 2008 Lack of association between adrenergic receptor genotypes and survival in heart failure patients treated with carvedilol or metoprolol.
18702937 Association study between reward dependence temperament and a polymorphism in the phenylethanolamine N-methyltransferase gene in a Japanese female population.
18679149 2008 Single nucleotide polymorphisms in genes of circulatory homeostasis in surviving pediatric intensive care patients with meningococcal infection.
18625943 2008 Intraocular pressure response to topical beta-blockers associated with an ADRB2 single-nucleotide polymorphism.
18622236 2008 Job strain, job demands and adrenergic beta1-receptor-polymorphism: a possible interaction affecting blood pressure in men.
18615004 2008 beta-adrenergic receptor gene polymorphisms and beta-blocker treatment outcomes in hypertension.
18596718 2008 Blood pressure and metabolic phenotypes in relation to the ADRB1 Arg389Gly and ADRA2B I/D polymorphisms in a White population.
18540901 2008 Transient tachypnea of the newborn (TTN): a role for polymorphisms in the beta-adrenergic receptor (ADRB) encoding genes?
18534365 2008 Common beta-adrenergic receptor polymorphisms are not associated with risk of sudden cardiac death in patients with coronary artery disease.
18479335 2008 Beta1 and beta2-adrenergic receptor polymorphisms and idiopathic ventricular arrhythmias.
18452871 2008 Polymorphisms in multiple genes are associated with resting heart rate in a stepwise allele-dependent manner.
18429752 2008 [Genetic aspects of individual sensitivity to betaxolol in patients with arterial hypertension].
18413560 2008 Association of beta1-adrenergic receptor genetic polymorphism with mental stress-induced myocardial ischemia in patients with coronary artery disease.
18413308 2008 Gene-load score of the renin-angiotensin-aldosterone system is associated with coronary heart disease in familial hypercholesterolaemia.
18403719 2008 Conformational rearrangements and signaling cascades involved in ligand-biased mitogen-activated protein kinase signaling through the beta1-adrenergic receptor.
18346809 2008 Mutations in the beta1 adrenergic receptor gene and massive obesity in Japanese.
18331634 2008 Adrenergic gene polymorphisms and cardiovascular risk in the NHLBI-sponsored Women's Ischemia Syndrome Evaluation.
18323523 2008 Beneficial effect of the central nervous system beta-adrenoceptor blockade on the failing heart.
18311486 2008 Expression and functional role of beta-adrenoceptors in the human urinary bladder urothelium.
18308161 2008 Neural control of heart rate is an arrhythmia risk modifier in long QT syndrome.
18298953 2008 Association of beta 1-adrenergic receptor gene polymorphisms with left ventricular hypertrophy in human essential hypertension.
18253135 2008 Beta-adrenergic receptor gene polymorphisms and hemodynamic response to dobutamine during dobutamine stress echocardiography.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18239290 2008 Adrenergic beta1 receptor polymorphism (Ser49Gly) is associated with obesity in type II diabetic patients.
18219297 2008 beta1- and beta2-adrenergic receptor gene variation, beta-blocker use and risk of myocardial infarction and stroke.
18209576 2008 Genetic variation within the beta1-adrenergic receptor gene results in haplotype-specific expression phenotypes.
18193079 2008 beta(1)- and beta(2)-adrenoceptor responses in cardiomyocytes derived from human embryonic stem cells: comparison with failing and non-failing adult human heart.
18158268 2008 Role of beta adrenergic receptor polymorphisms in heart failure: systematic review and meta-analysis.
18155231 2008 Adoptive passive transfer of rabbit beta1-adrenoceptor peptide immune cardiomyopathy into the Rag2-/- mouse: participation of the ER stress.
18075464 2007 Arg389Gly-beta1-adrenergic receptors determine improvement in left ventricular systolic function in nonischemic cardiomyopathy patients with heart failure after chronic treatment with carvedilol.
18059082 2008 Association of ADRB1 and UCP3 gene polymorphisms with insulin sensitivity but not obesity.
17998459 2007 Dynamic regulation of phosphoinositide 3-kinase-gamma activity and beta-adrenergic receptor trafficking in end-stage human heart failure.
17919552 2007 Effects of milrinone on contractility and cyclic adenosine monophosphate production induced by beta1- and beta2-adrenergic receptor activation in human myocardium.
17893006 2007 Association of beta-adrenoceptor polymorphisms with cardiac autonomic modulation in Japanese males.
17845930 2007 Cardiac reserve in the transplanted heart: effect of a graft polymorphism in the beta1-adrenoceptor.
17680533 2007 [389A/G polymorphism of the human beta1-adrenergic receptor in patients with acute myocardial infarction].
17667029 2007 Beta1- and beta2-adrenergic receptor polymorphisms affect susceptibility to idiopathic dilated cardiomyopathy.
17644825 2007 Genetic variation associated with ischemic heart failure: a HuGE review and meta-analysis.
17635183 2007 Association of CYP2D6 and ADRB1 genes with hypotensive and antichronotropic action of betaxolol in patients with arterial hypertension.
17591269 2007 [Association of beta-adrenoceptor gene polymorphism with resting heart rate].
17585213 2007 Adrenergic receptor genotype but not perioperative bisoprolol therapy may determine cardiovascular outcome in at-risk patients undergoing surgery with spinal block: the Swiss Beta Blocker in Spinal Anesthesia (BBSA) study: a double-blinded, placebo-controlled, multicenter trial with 1-year follow-up.
17541557 2007 In patients chronically treated with metoprolol, the demand of inotropic catecholamine support after coronary artery bypass grafting is determined by the Arg389Gly-beta 1-adrenoceptor polymorphism.
17512307 2007 Association analyses of adrenergic receptor polymorphisms with obesity and metabolic alterations.
17496726 2007 Synergistic polymorphisms of beta1 and alpha2C-adrenergic receptors and the influence on left ventricular ejection fraction response to beta-blocker therapy in heart failure.
17463065 2007 The Arg389Gly beta1-adrenergic receptor gene polymorphism and susceptibility to faint during head-up tilt test.
17383306 2007 A prospective evaluation of left ventricular remodeling after inaugural anterior myocardial infarction as a function of gene polymorphisms in the renin-angiotensin-aldosterone, adrenergic, and metalloproteinase systems.
17345787 2006 Genetic influences of beta-adrenoceptor polymorphisms on arterial functional changes and cardiac remodeling in hypertensive patients.
17339538 2007 Genetic variations associated with echocardiographic left ventricular traits in hypertensive blacks.
17335470 2007 Studies of associations between the Arg389Gly polymorphism of the beta1-adrenergic receptor gene (ADRB1) and hypertension and obesity in 7677 Danish white subjects.
17334644 2007 Association of gene polymorphisms with blood pressure and the prevalence of hypertension in community-dwelling Japanese individuals.
17329986 2007 Interethnic differences in drug response: the contribution of genetic variability in beta adrenergic receptor and cytochrome P4502C9.
17270896 2004 Association of beta-adrenoceptor single nucleotide polymorphisms with resting heart rate.
17223428 2007 Relation of beta(2)-adrenoceptor haplotype to risk of death and heart transplantation in patients with heart failure.
17217681 2006 [Beta1-adrenergic receptor (Arg389Gly) polymorphism and response to bisoprolol in patients with chronic heart failure].
17118120 2006 Golgin-160 promotes cell surface expression of the beta-1 adrenergic receptor.
17023080 2007 Beta1-adrenergic receptor polymorphisms, QTc interval and occurrence of symptoms in type 1 of long QT syndrome.
16997396 2006 CRM 1-mediated degradation and agonist-induced down-regulation of beta-adrenergic receptor mRNAs.
16946993 2006 Beta2-adrenergic receptor polymorphisms are associated with asthma and COPD in adults.
16940053 2006 AKAP79-mediated targeting of the cyclic AMP-dependent protein kinase to the beta1-adrenergic receptor promotes recycling and functional resensitization of the receptor.
16914520 2006 Association of 14-3-3 proteins to beta1-adrenergic receptors modulates Kv11.1 K+ channel activity in recombinant systems.
16907703 2006 Adrenergic receptor polymorphisms associated with resting heart rate: the HyperGEN Study.
16844790 2006 A polymorphism within a conserved beta(1)-adrenergic receptor motif alters cardiac function and beta-blocker response in human heart failure.
16815314 2006 beta1-Adrenergic receptor polymorphisms influence the response to metoprolol monotherapy in patients with essential hypertension.
16785856 2006 Polymorphism of beta-adrenergic receptors and susceptibility to open-angle glaucoma.
16765375 2006 Selective upregulation of beta1-adrenergic receptors and dephosphorylation of troponin I in end-stage heart failure patients supported by ventricular assist devices.
16760361 2006 Mutagenesis within helix 6 of the human beta1-adrenergic receptor identifies Lysine324 as a residue involved in imparting the high-affinity binding state of agonists.
16728691 2006 Adrenoceptor polymorphisms and the risk of cardiac injury and dysfunction after subarachnoid hemorrhage.
16648137 2006 Novel mutants of the human beta1-adrenergic receptor reveal amino acids relevant for receptor activation.
16534528 2006 Influence of lipoprotein lipase gene Ser447Stop and beta1-adrenergic receptor gene Arg389Gly polymorphisms and their interaction on obesity from childhood to adulthood: the Bogalusa Heart Study.
16500896 2006 Characterization of the residues in helix 8 of the human beta1-adrenergic receptor that are involved in coupling the receptor to G proteins.
16487965 2006 Beta1-adrenergic receptor gene polymorphisms in Mexican patients with idiopathic dilated cardiomyopathy.
16485781 2005 Beta1 adrenergic receptor polymorphisms Arg389Gly and Ser49Gly in the Amerindian and Mestizo populations of Mexico.
16421173 2006 The CAREGENE study: polymorphisms of the beta1-adrenoceptor gene and aerobic power in coronary artery disease.
16402084 Influence of phenotype and pharmacokinetics on beta-blocker drug target pharmacogenetics.
16325708 2005 Beta1-adrenergic receptor polymorphisms and clinical efficacy of betaxolol hydrochloride in normal volunteers.
16316992 2006 Proteomic analysis of beta1-adrenergic receptor interactions with PDZ scaffold proteins.
16315032 2005 Polymorphisms of genes CYP2D6, ADRB1 and GNAS1 in pharmacokinetics and systemic effects of ophthalmic timolol. A pilot study.
16287427 2006 What role do adrenoreceptor polymorphisms play in modifying cardiovascular responses in obstructive sleep apnoea?
16227135 2005 The impact of beta-adrenoreceptor gene polymorphisms on survival in patients with congestive heart failure.
16210433 2006 Effects of polymorphisms in beta1-adrenoceptor and alpha-subunit of G protein on heart rate and blood pressure during exercise test. The Finnish Cardiovascular Study.
16189366 2005 Beta2-adrenergic receptor genotype and survival among patients receiving beta-blocker therapy after an acute coronary syndrome.
16187973 2005 No positive association between adrenergic receptor variants of alpha2cDel322-325, beta1Ser49, beta1Arg389 and the risk for heart failure in the Japanese population.
16153393 2005 Ser49Gly of beta1-adrenergic receptor is associated with effective beta-blocker dose in dilated cardiomyopathy.
16122377 2006 Modifying effects of the R389G beta1-adrenoceptor polymorphism on resting heart rate and blood pressure in patients with obstructive sleep apnoea.
15932670 2005 [The relationship between expressions of beta1-, beta2-, beta3-adrenoceptor mRNA of myocardium and cardiac function in patients with heart failure].
15917856 2005 Association between beta-adrenergic receptor polymorphisms and their G-protein-coupled receptors with body mass index and obesity in women: a report from the NHLBI-sponsored WISE study.
15864115 2005 Beta1-adrenergic receptor polymorphisms and left ventricular remodeling changes in response to beta-blocker therapy.
15861037 2005 Association between beta-1 and beta-2 adrenergic receptor gene polymorphisms and the response to beta-blockade in patients with stable congestive heart failure.
15833937 2005 Interactive effects between polymorphisms in the beta-adrenergic receptors and longitudinal changes in obesity.
15824464 2004 The thiazide-sensitive Na(+)-Cl(-) cotransporter gene, C1784T, and adrenergic receptor-beta3 gene, T727C, may be gene polymorphisms susceptible to the antihypertensive effect of thiazide diuretics.
15735607 2005 beta-Adrenergic receptor polymorphisms and responses during titration of metoprolol controlled release/extended release in heart failure.
15719258 2005 Functional adrenergic receptor polymorphisms and idiopathic orthostatic intolerance.
15685248 2005 beta1-Adrenoceptor gene polymorphism predicts long-term changes in body weight.
15564877 2004 The Arg389Gly beta1-adrenoceptor gene polymorphism determines contractile response to catecholamines.
15542284 2004 Interaction between cardiac sympathetic drive and heart rate in heart failure: modulation by adrenergic receptor genotype.
15479221 2004 Variants in the human beta 1-, beta 2-, and beta 3-adrenergic receptor genes are not associated with morbid obesity in children and adolescents.
15464701 2004 Association of beta-adrenergic receptor polymorphisms and progression to heart failure in patients with idiopathic dilated cardiomyopathy.
15388645 2005 The 15-amino acid motif of the C terminus of the beta2-adrenergic receptor is sufficient to confer insulin-stimulated counterregulation to the beta1-adrenergic receptor.
15358775 2004 Interaction with cystic fibrosis transmembrane conductance regulator-associated ligand (CAL) inhibits beta1-adrenergic receptor surface expression.
15342173 2004 Role of beta1- and beta2-adrenoceptor polymorphisms in heart failure: a case-control study.
15331590 2004 Resistance of the human beta1-adrenergic receptor to agonist-induced ubiquitination: a mechanism for impaired receptor degradation.
15312808 2004 A polymorphism of the beta1-adrenergic receptor is associated with low extraversion.
15237695 2004 Beta1-adrenergic receptor gene polymorphisms and response to beta1-adrenergic receptor blockade in patients with essential hypertension.
15212839 2004 Polymorphism in genes involved in adrenergic signaling associated with Alzheimer's.
15212591 2004 Frequency of compound genotypes associated with beta-blocker efficacy in congestive heart failure.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15086532 2004 Identification of a novel family of G protein-coupled receptor associated sorting proteins.
15079793 2004 [The genotype analysis of beta adrenergic receptor gene family in high risk population of hypertension in northeast China].
15055253 2004 Association between hypertension and the alpha-adducin, beta1-adrenoreceptor, and G-protein beta3 subunit genes in the Japanese population; the Suita study.
14990580 2004 Role of the cyclic AMP-dependent protein kinase in homologous resensitization of the beta1-adrenergic receptor.
14734649 2004 Differences in endosomal targeting of human (beta)1- and (beta)2-adrenergic receptors following clathrin-mediated endocytosis.
14553962 2003 Effects of endothelial nitric oxide synthase, alpha-adducin, and other candidate gene polymorphisms on blood pressure response to hydrochlorothiazide.
14534524 2003 Gly389Arg polymorphism of beta1-adrenergic receptor is associated with the cardiovascular response to metoprolol.
14502278 2003 Beta 1-adrenergic receptor polymorphisms confer differential function and predisposition to heart failure.
12921807 2003 An evaluation of the beta-1 adrenergic receptor Arg389Gly polymorphism in individuals with heart failure: a MERIT-HF sub-study.
12851615 2003 Arg389Gly polymorphism of the human beta1-adrenergic receptor in patients with nonfatal acute myocardial infarction.
12847069 2003 Partial agonist activity of bucindolol is dependent on the activation state of the human beta1-adrenergic receptor.
12844134 2003 Beta 1-adrenergic receptor polymorphisms and antihypertensive response to metoprolol.
12815745 2003 Beta-1-adrenergic receptor gene in major depression: influence on antidepressant treatment response.
12724327 2003 GIPC interacts with the beta1-adrenergic receptor and regulates beta1-adrenergic receptor-mediated ERK activation.
12709726 2003 A common beta1-adrenergic receptor polymorphism (Arg389Gly) affects blood pressure response to beta-blockade.
12643891 2003 The genetic determination of left ventricular mass in healthy adults.
12544508 2003 A microarray minisequencing system for pharmacogenetic profiling of antihypertensive drug response.
12529373 2003 Heterodimerization of alpha 2A- and beta 1-adrenergic receptors.
12519093 2003 Effects of common polymorphisms in the alpha1A-, alpha2B-, beta1- and beta2-adrenoreceptors on haemodynamic responses to adrenaline.
12455717 Variation at the beta-1 adrenoceptor gene locus affects left ventricular mass in renal failure.
12422153 2002 Polymorphisms of the beta1-adrenergic receptor predict exercise capacity in heart failure.
12391161 2002 Direct binding of the beta1 adrenergic receptor to the cyclic AMP-dependent guanine nucleotide exchange factor CNrasGEF leads to Ras activation.
12374873 2002 Synergistic polymorphisms of beta1- and alpha2C-adrenergic receptors and the risk of congestive heart failure.
12270132 2002 Glycosylation of beta(1)-adrenergic receptors regulates receptor surface expression and dimerization.
12244098 2002 Quantitative assessment of beta 1- and beta 2-adrenergic receptor homo- and heterodimerization by bioluminescence resonance energy transfer.
12197595 2002 Suppressive effect of the Gly389 allele of the beta1-adrenergic receptor gene on the occurrence of ventricular tachycardia in dilated cardiomyopathy.
12140284 2002 Beta 1/beta 2-adrenergic receptor heterodimerization regulates beta 2-adrenergic receptor internalization and ERK signaling efficacy.
12106601 2002 Similarities and differences in the coupling of human beta1- and beta2-adrenoceptors to Gs(alpha) splice variants.
12090746 2002 An evaluation of the beta-1 adrenergic receptor Arg389Gly polymorphism in individuals at risk of coronary events. A WOSCOPS substudy.
12036966 2002 Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.
12029453 2002 Sudden infant death: no evidence for linkage to common polymorphisms in the uncoupling protein-1 and the beta3-adrenergic receptor genes.
12023679 2002 Variability within alpha- and beta-adrenoreceptor genes as a predictor of cardiovascular function at rest and in response to mental challenge.
11942593 2002 Polymorphisms in beta-adrenergic receptor genes in the acquired long QT syndrome.
11854867 2002 A polymorphism in the beta1 adrenergic receptor is associated with resting heart rate.
11753577 2001 The Arg 389 Gly beta1-adrenergic receptor gene polymorphism and human fat cell lipolysis.
11700307 2002 G protein-coupled receptor kinase 5 regulates beta 1-adrenergic receptor association with PSD-95.
11526121 2001 beta 1-adrenergic receptor association with the synaptic scaffolding protein membrane-associated guanylate kinase inverted-2 (MAGI-2). Differential regulation of receptor internalization by MAGI-2 and PSD-95.
11447084 2001 Polymorphism in the beta(1)-adrenergic receptor gene and hypertension.
11337934 2001 Arg389Gly beta 1-adrenoceptor polymorphism varies in frequency among different ethnic groups but does not alter response in vivo.
11140838 2000 A multivariate analysis of 59 candidate genes in personality traits: the temperament and character inventory.
11052857 2000 A novel polymorphism in the gene coding for the beta(1)-adrenergic receptor associated with survival in patients with heart failure.
10995758 2000 beta 1-adrenergic receptor association with PSD-95. Inhibition of receptor internalization and facilitation of beta 1-adrenergic receptor interaction with N-methyl-D-aspartate receptors.
10862778 2000 Interaction with beta-arrestin determines the difference in internalization behavor between beta1- and beta2-adrenergic receptors.
10794544 2000 Beta1-adrenoceptor gene variations: a role in idiopathic dilated cardiomyopathy?
10535961 1999 Identification of the endophilins (SH3p4/p8/p13) as novel binding partners for the beta1-adrenergic receptor.
10477438 1999 Racial differences in the frequencies of cardiac beta(1)-adrenergic receptor polymorphisms: analysis of c145A>G and c1165G>C.
10212248 1999 A gain-of-function polymorphism in a G-protein coupling domain of the human beta1-adrenergic receptor.
9843378 1998 SH3 binding domains in the dopamine D4 receptor.
8892658 1996 Structural and functional analysis of the B cell epitopes recognized by anti-receptor autoantibodies in patients with Chagas' disease.
7583452 1995 Genetic mapping of adrenergic receptor genes in humans.
6305985 1983 The cardiac beta-adrenergic receptor. Structural similarities of beta 1 and beta 2 receptor subtypes demonstrated by photoaffinity labeling.
2825170 1987 Cloning of the cDNA for the human beta 1-adrenergic receptor.
2536864 1989 The effect of Escherichia coli endotoxin on the adrenergic control of lipolysis in the human adipocyte.
2465637 1988 Human beta 1- and beta 2-adrenergic receptors: structurally and functionally related receptors derived from distinct genes.
2154750 1990 Chromosomal organization of adrenergic receptor genes.