Property Summary

Ligand Count 303
NCBI Gene PubMed Count 338
PubMed Score 725.78
PubTator Score 921.50

Knowledge Summary

Patent (8,190)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Essential Hypertension 94 0.0 3.0
Lipid storage disease 8 0.0 1.4

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease -1.366 2.5e-02
adult high grade glioma -1.100 6.7e-03
astrocytic glioma -3.500 2.5e-03
Astrocytoma, Pilocytic -2.600 1.2e-04
Atopic dermatitis -1.600 5.2e-04
atypical teratoid / rhabdoid tumor -1.400 1.1e-07
chronic rhinosinusitis -1.984 3.3e-02
ductal carcinoma in situ -3.400 3.9e-03
ependymoma -4.400 2.5e-03
glioblastoma -1.600 1.7e-02
group 3 medulloblastoma -5.100 6.6e-05
head and neck cancer and chronic obstruc... -1.300 1.1e-03
interstitial cystitis -2.500 6.3e-04
interstitial lung disease -1.700 4.8e-02
invasive ductal carcinoma -4.300 1.2e-04
lung adenocarcinoma -1.300 1.5e-15
lung carcinoma -1.100 1.4e-08
medulloblastoma, large-cell -3.700 1.8e-02
non-small cell lung cancer -3.754 8.2e-27
oligodendroglioma -2.600 1.0e-02
osteosarcoma -2.658 5.7e-05
pancreatic cancer -2.200 4.5e-03
pancreatic carcinoma -2.200 4.5e-03
primitive neuroectodermal tumor -1.500 6.4e-05
psoriasis -1.100 4.1e-07
tuberculosis 1.400 3.7e-03

Gene RIF (367)

AA Sequence

MGAGVLVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPASESPEPLSQQWTAGMGLLMALIVL      1 - 70
LIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVL     71 - 140
CVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVCTVWAISALVSFLPILMHWWRAESDEARRCY    141 - 210
NDPKCCDFVTNRAYAIASSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPSPV    211 - 280
PAPAPPPGPPRPAAAAATAPLANGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFH    281 - 350
RELVPDRLFVFFNWLGYANSAFNPIIYCRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGP    351 - 420
PPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV                 421 - 477
//

Text Mined References (339)

PMID Year Title