Property Summary

NCBI Gene PubMed Count 36
PubMed Score 46.90
PubTator Score 16.75

Knowledge Summary

Patent (5,312)

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma -2.903 7.6e-04
adrenocortical carcinoma -1.217 8.9e-07
non-small cell lung cancer -1.813 8.6e-11
intraductal papillary-mucinous adenoma (... 2.200 1.3e-02
lung cancer -3.400 2.6e-05
active Crohn's disease 1.597 2.5e-03
ulcerative colitis 2.400 1.2e-05
pancreatic cancer 1.500 4.2e-04
interstitial cystitis -2.200 1.0e-04
lung adenocarcinoma -1.400 5.4e-13
atypical teratoid/rhabdoid tumor 1.100 5.0e-02
group 3 medulloblastoma -1.100 3.3e-02
spina bifida -2.286 3.6e-02
acute myeloid leukemia -2.300 3.6e-02
ovarian cancer -3.300 2.8e-05

Pathway (1)

Gene RIF (16)

PMID Text
26004201 Mutations of GPR126 are responsible for severe arthrogryposis multiplex congenita.
25954032 Together, these data uncover Gpr126 as a genetic cause for the pathogenesis of Adolescent idiopathic scoliosis (AIS) and pectus excavatum in a mouse model.
25479386 Genetic variants of GPR126 gene are associated with adolescent idiopathic scoliosis susceptibility in Chinese populations.
25217645 GPR126 modulates both physiological and pathological angiogenesis through VEGF signaling
24227709 Gpr126 functions in Schwann cells for proper development and myelination through G-protein-signaling pathways.
23666238 A single nucleotide polymorphism in the GPR126 gene is associated with increased susceptibility for adolescent idiopathic scoliosis. [Meta-analysis]
21929287 Possible new targets for GPCR modulation: allosteric interactions, plasma membrane domains, intercellular transfer and epigenetic mechanisms.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20546612 Observational study of gene-disease association. (HuGE Navigator)
20397748 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20010835 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19266077 Observational study of gene-disease association. (HuGE Navigator)
18304421 The PS1TP2 gene was located at 6q24.1, and interacts with leukocyte proteins.
17109822 APG1 formed an alpha-helical structure at the C-terminal site and a positive charge cluster at the N-terminal site.
15225624 VIGR represents a novel G protein coupled receptors of the adhesion family, which is unique in its long extra-cellular domain.

AA Sequence

MMFRSDRMWSCHWKWKPSPLLFLFALYIMCVPHSVWGCANCRVVLSNPSGTFTSPCYPNDYPNSQACMWT      1 - 70
LRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKK     71 - 140
GFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPELSAFTLCFEATKVGHEDSDWTAFSYSNASFT    141 - 210
QLLSFGKAKSGYFLSISDSKCLLNNALPVKEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDST    211 - 280
ISKVIPGNGKLLLGSNQNEIVSLKGDIYNFRLWNFTMNAKILSNLSCNVKGNVVDWQNDFWNIPNLALKA    281 - 350
ESNLSCGSYLIPLPAAELASCADLGTLCQATVNSPSTTPPTVTTNMPVTNRIDKQRNDGIIYRISVVIQN    351 - 420
ILRHPEVKVQSKVAEWLNSTFQNWNYTVYVVNISFHLSAGEDKIKVKRSLEDEPRLVLWALLVYNATNNT    421 - 490
NLEGKIIQQKLLKNNESLDEGLRLHTVNVRQLGHCLAMEEPKGYYWPSIQPSEYVLPCPDKPGFSASRIC    491 - 560
FYNATNPLVTYWGPVDISNCLKEANEVANQILNLTADGQNLTSANITNIVEQVKRIVNKEENIDITLGST    561 - 630
LMNIFSNILSSSDSDLLESSSEALKTIDELAFKIDLNSTSHVNITTRNLALSVSSLLPGTNAISNFSIGL    631 - 700
PSNNESYFQMDFESGQVDPLASVILPPNLLENLSPEDSVLVRRAQFTFFNKTGLFQDVGPQRKTLVSYVM    701 - 770
ACSIGNITIQNLKDPVQIKIKHTRTQEVHHPICAFWDLNKNKSFGGWNTSGCVAHRDSDASETVCLCNHF    771 - 840
THFGVLMDLPRSASQLDARNTKVLTFISYIGCGISAIFSAATLLTYVAFEKLRRDYPSKILMNLSTALLF    841 - 910
LNLLFLLDGWITSFNVDGLCIAVAVLLHFFLLATFTWMGLEAIHMYIALVKVFNTYIRRYILKFCIIGWG    911 - 980
LPALVVSVVLASRNNNEVYGKESYGKEKGDEFCWIQDPVIFYVTCAGYFGVMFFLNIAMFIVVMVQICGR    981 - 1050
NGKRSNRTLREEVLRNLRSVVSLTFLLGMTWGFAFFAWGPLNIPFMYLFSIFNSLQGLFIFIFHCAMKEN   1051 - 1120
VQKQWRQHLCCGRFRLADNSDWSKTATNIIKKSSDNLGKSLSSSSIGSNSTYLTSKSKSSSTTYFKRNSH   1121 - 1190
TDNVSYEHSFNKSGSLRQCFHGQVLVKTGPC                                          1191 - 1221
//

Text Mined References (40)

PMID Year Title
26004201 2015 Mutations of GPR126 are responsible for severe arthrogryposis multiplex congenita.
25954032 2015 Gpr126/Adgrg6 deletion in cartilage models idiopathic scoliosis and pectus excavatum in mice.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
25479386 2015 Association of GPR126 gene polymorphism with adolescent idiopathic scoliosis in Chinese populations.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25217645 2014 GPR126 protein regulates developmental and pathological angiogenesis through modulation of VEGFR2 receptor signaling.
25118328 2014 Type IV collagen is an activating ligand for the adhesion G protein-coupled receptor GPR126.
24227709 2013 Gpr126 functions in Schwann cells to control differentiation and myelination via G-protein activation.
23666238 2013 Genetic variants in GPR126 are associated with adolescent idiopathic scoliosis.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
22837378 2012 Genome-wide association studies identify CHRNA5/3 and HTR4 in the development of airflow obstruction.
21929287 2011 Possible new targets for GPCR modulation: allosteric interactions, plasma membrane domains, intercellular transfer and epigenetic mechanisms.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20397748 2010 Genome-wide association study of height and body mass index in Australian twin families.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20010835 2010 Meta-analyses of genome-wide association studies identify multiple loci associated with pulmonary function.
19343178 2009 Meta-analysis of genome-wide scans for human adult stature identifies novel Loci and associations with measures of skeletal frame size.
19266077 2009 Genetic determinants of height growth assessed longitudinally from infancy to adulthood in the northern Finland birth cohort 1966.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
18304421 2008 [Protein expression and function of gene 2 transregulated by hepatitis B virus pre-s1 protein and its cloning].
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17109822 2007 NMR structure of a human homologous methuselah gene receptor peptide.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15225624 2004 VIGR--a novel inducible adhesion family G-protein coupled receptor in endothelial cells.
15203201 2004 The human and mouse repertoire of the adhesion family of G-protein-coupled receptors.
15189448 2004 DREG, a developmentally regulated G protein-coupled receptor containing two conserved proteolytic cleavage sites.
15084671 2004 A proteomic analysis of human bile.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12565841 2003 There exist at least 30 human G-protein-coupled receptors with long Ser/Thr-rich N-termini.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12119602 2002 Major recessive gene(s) with considerable residual polygenic effect regulating adult height: confirmation of genomewide scan results for chromosomes 6, 9, and 12.
11410839 2001 Genomewide linkage analysis of stature in multiple populations reveals several regions with evidence of linkage to adult height.
8076819 1994 The addition of 5'-coding information to a 3'-directed cDNA library improves analysis of gene expression.