Property Summary

NCBI Gene PubMed Count 197
PubMed Score 275.85
PubTator Score 227.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Rheumatoid Arthritis 1.200 1.2e-03
astrocytic glioma 1.200 1.4e-02
ependymoma 1.100 3.7e-02
oligodendroglioma 1.500 2.1e-03
osteosarcoma 2.306 7.3e-09
medulloblastoma, large-cell -1.300 1.1e-03
primary pancreatic ductal adenocarcinoma 1.007 2.0e-03
subependymal giant cell astrocytoma -1.282 3.3e-02
gastric carcinoma 1.100 9.1e-03
ovarian cancer -1.800 2.6e-07

Protein-protein Interaction (9)

Gene RIF (212)

PMID Text
27349000 study shows that the a-adducin G460T polymorphism is associated with essential hypertension
27340988 This indicates that ADD1 G460W polymorphism could be an important factor in the pathophysiology of tinnitus.
26042478 The T allele of ADD1 is associated with essential hypertension in Asians.
25816007 Study shows that ADD1-rs4963 conferred susceptibility to colorectal cancer (CRC) suggesting an association between ADD1 and CRC risk.
25567773 study of potential effects of interaction between DNA methylation of ADD1 promoter and ADD1 tagSNPs and environmental factors on essential hypertension (EH); results indicate ADD1 SNP rs4961 has a protective role in development of EH; interactions between alcohol consumption and DNA methylation of ADD1 gene promoter have a significant role in modifying EH susceptibility
25344630 When alpha-adducin complexes with sodium potassium ATPase in astrocytes, non-cell autonomous neurodegeneration is triggered.
25262176 There were significant differences between the control group and pediatric hypertensive group in terms of ACE I/D (P<0.05) and AGT M235T (P<0.05) polymorphisms, but there were no differences in ADD Gly460Trp (P>0.05) polymorphism.
24718403 A significant association was found between ADD1 gene G614T polymorphism and essential hypertension in Chinese patients. Further studies need to be done to confirm these findings in a large sample.
24711455 Data indicate that adducin promotes adhesion by regulating desmosomes and is part of a protective pathway in pemphigus.
24379415 Phosphorylation of ADD1 at Ser12 and Ser355 by cyclin-dependent kinase 1 enables ADD1 to bind to myosin-X (Myo10).
23985264 Fnnctional polymorphism in the phosphorylation site of ADD1 (rs4963) may influence the susceptibility of non-cardia gastric cancer.
23863317 study is the first meta-analysis to evaluate the influences of ACE and ADD1 polymorphisms on blood pressure responses to hydrochlorothiazide to combine the inconsistent results of previous studies
23691048 concentration of AST was inversely correlated with ADD1 CpG2-5 methylation levels in female controls. These observations may bring new hints to elaborate the pathogenesis of essential hypertension
23540412 there was no association of ACE and ADD1 gene polymorphism in ischaemic stroke patients
23509723 the rs4963 polymorphism within ADD1 gene is associated with essential hypertension in the Chinese population
23284854 Hypertension-linked mutation of alpha-adducin increases CFTR surface expression and activity in HEK and cultured rat distal convoluted tubule cells.
22810272 role of ADD1 gene polymorphism in hypertension
22677360 The alpha-adducin Gly460Trp gene polymorphism might modulate renal function decline in the Chinese.
22476228 genetic variants of the ADD1 and GNB3 genes may have important roles in blood pressure response to the cold pressor test
22307086 Findings support a role for alpha-adducin in memory from nematodes to humans.
22272309 Data show that alpha-adducin G460W gene polymorphism was linked to essential hypertension (EH) susceptibility.
22198647 Variant genotype combinations of ACE and alphaADDUCIN render the hypertensive patient more vulnerable to recurrent intracerebral hemorrhage
22197999 Further studies involving siRNA-mediated knockdowns of spectrin, adducin, or p4.1 revealed that those proteins are needed for efficient docking of enterohaemorrhagic Escherichia coli to host cells.
22163289 organization of a spectrin-like cytoskeleton is associated with keratinocyte differentiation, and cytoskeleton disruption is mediated by either PKCdelta(Thr505) phosphorylation associated with phosphorylated adducin or due to reduction of endogenous adducin
22117679 In the studied Russian population G460W polymorphism of ADD1 gene can be considered as predisposition gene to hypertension, but its pathological effect is manifested solely under influence of environmental factors.
21736685 the mechanism for alpha-adducin to shuttle between the cytoplasm and nucleus; a potential role for alpha-adducin in mitosis.
21364877 Null association of alpha-adducin G460T and GNB3 C825T polymorphisms with hypertension in Chinese, but local marginal significance of C825T, as a putative salt-sensitive switch, in southern Chinese.
21339657 ADD1 variant genotypes were not associated with increased risk but in association with ACE DD genotype resulted in significantly higher risk of PSICH. ACE and ADD1 variant genotypes were associated with nonlobar hematoma.
21228790 this meta-analysis suggests that the Gly460Trp polymorphism might increase the risk of hypertension in Chinese populations, especially in Han Chinese.
21194526 genotype and allele frequencies of ACE and ADD1 polymorphisms were compared between patients and controls as well as between ischemic stroke and ICH
20929695 Genetic variration in alpha adducion alter renal function and/or vasoreactivity are logical candidates to explain some of the individual variability in the blood pressure response to exercise.
20929695 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20927398 Alpha-adducin Gly460Trp polymorphism is associated with hypertension.
20927398 Meta-analysis of gene-disease association. (HuGE Navigator)
20877298 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20838486 Meta-analysis of gene-disease association. (HuGE Navigator)
20810786 These findings suggest novel roles for adducins in stabilization of epithelial junctions and regulation of junctional remodeling.
20667857 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20577119 Observational study of gene-disease association. (HuGE Navigator)
20565774 Observational study of genotype prevalence. (HuGE Navigator)
20536507 Observational study of gene-disease association. (HuGE Navigator)
20473689 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20160191 Meta-analysis of gene-disease association. (HuGE Navigator)
20145305 Alpha-adducin Gly460Trp polymorphism is associated with salt-sensitivity.
20145305 Meta-analysis of gene-disease association. (HuGE Navigator)
19960031 The alpha-adducin gene G460W polymorphism was not associated with hypertension in either a case-control study of essential hypertension in Shangha residents or in a meta-analysis of all reports in English.
19960031 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19838659 ALPHA AND BETA ADDUCIN POLYMORPHISMS AFFECT DECLINE OF RENAL FUNCTION IN HUMAN IGA NEPHROPATHY.
19838659 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19779464 effects of environmental, demographic, & genetic factors & their interactions to SBP response to antihypertensive drugs, explained 23% of the total variance. Ethnicity, low sodium intake, & ADD1 614G-->T polymorphism were the only drug-related predictors
19779464 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19779330 Observational study of gene-disease association. (HuGE Navigator)
19729965 Observational study of gene-disease association. (HuGE Navigator)
19620885 Although the effect of both genetic variants on CIMT was small, this study showed a statistically significant effect of AGTR1 and ADD1 in women
19620885 Observational study of gene-disease association. (HuGE Navigator)
19574959 data support a role for the ADD1 and GNB3 genes in blood pressure salt sensitivity
19567882 Adducin forms a bridge between the erythrocyte membrane and its cytoskeleton and regulates membrane cohesion
19559392 Observational study of gene-disease association. (HuGE Navigator)
19479237 Observational study of gene-disease association. (HuGE Navigator)
19443911 genotype combination of the 3 polymorphisms was not statistically different in preeclampsia cases versus controls, nor were ACE and ADD1 polymorphisms in gestational hypertension
19274077 Genetic variants in the angiotensinogen, angiotensin II type 1 receptor and alpha-adducin genes may contribute to loss of renal function in the general female Caucasian population.
19274077 Observational study of gene-disease association. (HuGE Navigator)
19263529 Observational study of gene-disease association. (HuGE Navigator)
19247266 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19243623 Observational study of gene-disease association. (HuGE Navigator)
19242491 Observational study of gene-disease association. (HuGE Navigator)
19238444 HuGE review of gene-disease association and gene-environment interaction. (HuGE Navigator)
19199261 The rs4961 polymorphism of the ADD1 gene is associated with essential hypertension, but the rs28933400 locus in the ATP1A2 gene may have no association with essential hypertension in the studied population.
19199261 Observational study of gene-disease association. (HuGE Navigator)
19166692 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19148102 no significant association between G460W polymorphism and mean retinal arteriolar and venular calibre
19148102 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19145770 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19145769 alpha-adducin gene does not play an important role in modifying the risk of nonfatal myocardial infarction associated with the use of thiazide diuretics.
19145769 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19131662 Meta-analysis of gene-disease association. (HuGE Navigator)
19103106 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19057513 Common polymorphisms of ADD1, AGT, ACE, and AGTR1 do not markedly predict BP responses to amlodipine, bisoprolol, HCT, and losartan, at least in white hypertensive men.
19057513 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19047752 Alpha-adducin and Raf-1 kinase are redistributed and localized to the inclusion membrane in Chlamydia and Chlamydophila infected cells.
18977990 Observational study of gene-disease association. (HuGE Navigator)
18800139 alpha-adducin (ADD1) and angiotensin II type 1 receptor (AT1R) interactively determine the elastic properties of the femoral artery.
18800139 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18787518 Observational study of gene-disease association. (HuGE Navigator)
18679149 Among patients admitted to the PICU with a meningococcal infection, the variant allele of the alpha-adducin gene was more prevalent compared with controls
18679149 Observational study of gene-disease association. (HuGE Navigator)
18667944 alpha-adducin mutation as a possible mechanism of endolymphatic hydrops in Meniere's syndrome.
18667944 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18657677 In hypertensive patients with coronary artery disease, black ADD1 variant carriers had a 2.6-fold excess risk for a primary outcome event and an 8-fold increase risk of death. White and Hispanic carriers had an increased but nonsignificant excess risk.
18591455 Physiological interaction between the ADD1 and WNK1-NEDD4L pathways influences the effects of variants in these genes on sodium-related BP regulation.
18591455 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18524856 The constitutive reduction of the Na/K pump endocytic rate induced by mutated adducin variants may be relevant in Na-dependent hypertension.
18513389 Observational study of gene-disease association. (HuGE Navigator)
18475162 Left ventricular diastolic relaxation is modulated by genetic variation in ADD1.
18475162 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18458162 prospective study in a population based cohort of Dutch women strongly suggest that presence of the alpha-adducin Gly460Trp polymorphism increases the risk of stroke
18458162 Observational study of gene-disease association. (HuGE Navigator)
18413308 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18398333 patients with ADD1 Trp alleles are sensitive to salt and tubular Na reabsorption remains elevated after volume expansion
18398333 Observational study of gene-disease association. (HuGE Navigator)
18393230 Data show that the alpha-adducin gene TT and ACE II genotypes might be genetic susceptibility factors to hypertension accompanying renal injury.
18393230 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18003973 Adducin acting through spectrin provides a novel mechanism to regulate global properties of the lateral membrane of bronchial epithelial cells.
17984662 Observational study of gene-disease association. (HuGE Navigator)
17984662 The ADD1 Gly460Trp polymorphism is significantly associated with an increased risk of coronary artery disease as well as blood pressure, indicating that ADD1 plays a role in the pathogenesis of coronary artery disease as well as hypertension.
17921817 in essential hypertensives the 460Trp allele of ADD1 is strongly associated with an impaired endothelium-dependent vasodilation, a powerful predictor of cardiovascular risk.
17825147 Observational study of gene-disease association. (HuGE Navigator)
17765140 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17765140 data suggest that the adducin-1 G460W polymorphism influences blood pressure when body mass in and sex are taken into account
17472579 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17472579 major finding of the present study was that the a-adducin Gly460Trp polymorphism interacted with exercise intensity to alter the systolic blood pressure response to acute dynamic exercise
17452507 Observational study of gene-disease association. (HuGE Navigator)
17452507 The angiotensin-converting enzyme (ACE) I/D and the alpha-adducin (ADD1) Gly460Trp polymorphisms are associated with cardiovascular risk factors.
17301826 Observational study of gene-disease association. (HuGE Navigator)
17267840 Observational study of gene-disease association. (HuGE Navigator)
17215849 Observational study of gene-disease association. (HuGE Navigator)
17189961 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17189961 ADD1 polymorphism did not influence the effect of low-ceiling diuretics on the risk of myocardial infarction/stroke.
17083073 Observational study of gene-disease association. (HuGE Navigator)
17082469 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17051589 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17003363 Observational study of gene-disease association. (HuGE Navigator)
17003363 ADD1 gene contributes to risk of hypertension & increases mean common carotid IMT in patients with NIDDM. Study indicates that ADD1 polymorphism could be useful in identifying hypertensive NIDDM patients with high risk of mortality.
16970091 Observational study of gene-disease association. (HuGE Navigator)
16724011 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16724011 The alpha-adducin G460W polymorphism and the angiotensinogen M235T polymorphism did not modify the difference in blood pressure levels among subjects who used diuretics, beta-blockers, calcium antagonists, or ACE inhibitors.
16702981 Clinical trial of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16615274 Observational study of gene-disease association. (HuGE Navigator)
16612256 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16612256 ADD1 and ACE polymorphisms in hypertension have a joint influence on albuminuria.
16531798 Observational study of gene-disease association. (HuGE Navigator)
16531798 The 460Trp allele of ADD1 contributes substantially to increase carotid artery intima-media thickness, in a male hormonal milieu only, at least in the young age range.
16497648 Observational study of gene-disease association. (HuGE Navigator)
16450155 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16420563 Observational study of gene-disease association. (HuGE Navigator)
16392768 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
16314886 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16289097 The binding of alpha Adducin to RFX-I and their nuclear co-localization suggests that Adducin can have a role in modulating the transcriptional regulating activity of RFX-I.
16266470 The alpha-adducin G614T polymorphism is associated with the antihypertensive effect of hydrochlorothiazide.
16266470 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16100725 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16080807 In the JingNing population, the adducin 460Trp allele was associated with lower levels of central systolic pressure and pulse pressure.
16080807 Observational study of gene-disease association. (HuGE Navigator)
16043664 Observational study of gene-disease association. (HuGE Navigator)
16043664 Alpha-adducin Gly460Trp polymorphism, in combination with systolic blood pressure, is a strong predictor of cardiovascular mortality and morbidity.
15910744 These results suggest that Rho-kinase regulates the association of alpha-adducin and spectrin with the actin cytoskeleton in platelet activation.
15834281 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15824464 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15773232 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15773232 interaction effect of alpha-adducin Gly460Trp and ACE I/D polymorphisms might play a significant role in regulating baseline BP but not BP response to Benazepril.
15716695 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15716695 The interaction of ADD1 and ADD3 gene variants in humans is statistically associated with variation in blood pressure, suggesting the presence of epistatic effects among these loci.
15608390 Observational study of gene-disease association. (HuGE Navigator)
15554870 Observational study of gene-disease association. (HuGE Navigator)
15493144 Observational study of gene-disease association. (HuGE Navigator)
15378162 Renal function in relation to ADD1 was studied in a Han population.
15326084 Observational study of gene-environment interaction. (HuGE Navigator)
15326084 The present study shows that the Trp460Trp genotype of the alpha-adducin gene is significantly associated with reduced renal plasma flow and glomerular filtration rate.
15187197 Observational study of gene-disease association. (HuGE Navigator)
15110895 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15110895 The alpha-adducin WW genotype was associated with higher systolic BP among men with a higher sodium intake.
15097233 The ACE I/D, alpha-adducin Gly460Trp and aldosterone synthase -344C/T polymorphisms interact to influence systolic blood pressure in Chinese, suggesting that these genes might indeed predispose to hypertension
15059531 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15055253 Observational study of gene-disease association. (HuGE Navigator)
15055253 the ADD1/ G460W polymorphism was associated with hypertension in female subjects.
15039125 Observational study of gene-disease association. (HuGE Navigator)
14643575 Observational study of gene-disease association. (HuGE Navigator)
14643575 In healthy Venezuelan normotensive adults, there is no association between the alpha-adducin 460Trp mutation (G/T), and the state of salt sensitivity or the level of blood pressure.
14553962 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
14530292 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
14508192 Observational study of gene-disease association. (HuGE Navigator)
14508192 positive association between the alpha-adducin G460W polymorphism and essential hypertension in a northern Chinese population
13679477 Observational study of gene-disease association. (HuGE Navigator)
13679477 In the series of ADPKD patients no effects was found of the ACE(I/D) polymorphism on the age at ESRD.
12885793 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12697976 Observational study of gene-disease association. (HuGE Navigator)
12697976 The ACE and alpha-adducin polymorphisms do not play a significant role in the progression of autosomal dominant polycystic kidney to end stage renal failure
12623934 Observational study of gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12427140 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
12427140 inhibition of the renin-aldosterone system in men and absence of such a compensatory mechanism in women may explain, at least to some extent, the sexual dimorphism of the blood pressure phenotype in relation to the C1797T beta-adducin polymorphism.
12394950 Observational study of gene-disease association. (HuGE Navigator)
12195119 Observational study of gene-disease association. (HuGE Navigator)
12195119 The Gly460Trp polymorphism of ADD-1 is associated with low renin hypertension.
12195118 Observational study of gene-disease association. (HuGE Navigator)
12195118 Patients homozygous for the allele of that polymorphism had a LV mass index significantly higher compared with heterozygotes or homozygotes. These subjects also have significantly lower plasma renin activity.
12172317 Observational study of gene-disease association. (HuGE Navigator)
12172317 Carotid and femoral intima-media thickness were assessed in subjects genotyped for the presence of the ACE D, aldosterone synthase -344T and alpha-adducin 460Trp alleles.
12107246 Observational study of gene-disease association. (HuGE Navigator)
12107246 Blood pressure in patients with primary aldosteronism is influenced by alpha-adducin gene polymorphisms.
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12052841 Observational study of gene-disease association. (HuGE Navigator)
12052841 ADD1 460W allele associated with cardiovascular disease in hypertensive individuals
11926892 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11926892 interaction between diuretic therapy and the adducin variant on the incidence of myocardial infarction and stroke
11918988 Observational study of gene-disease association. (HuGE Navigator)
11918733 Observational study of gene-disease association. (HuGE Navigator)
11918733 Role of the alpha-adducin genotype on renal disease progression.
11882573 Observational study of gene-disease association. (HuGE Navigator)
11847182 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11775124 Observational study of gene-disease association. (HuGE Navigator)
11728946 Observational study of gene-disease association. (HuGE Navigator)
11711521 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
11528213 Observational study of gene-disease association. (HuGE Navigator)
11518842 Observational study of gene-disease association. (HuGE Navigator)
11447495 Observational study of gene-disease association. (HuGE Navigator)
11283377 Observational study of gene-disease association. (HuGE Navigator)
11116113 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
11110979 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDLRQDFNMMEQKKRVSMILQSPAFCEE      1 - 70
LESMIQEQFKKGKNPTGLLALQQIADFMTTNVPNVYPAAPQGGMAALNMSLGMVTPVNDLRGSDSIAYDK     71 - 140
GEKLLRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHFLIVPFGLLYSEVTASSLVKINLQGDIVDRG    141 - 210
STNLGVNQAGFTLHSAIYAARPDVKCVVHIHTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDE    211 - 280
EEKVLIQKNLGPKSKVLILRNHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYK    281 - 350
AKSRSPGSPVGEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPALREKSKKYSDVEVPASVTGYS    351 - 420
FASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASEEGQNGSSPKSKTKWTKEDGHRTSTSAVPNLFV    421 - 490
PLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVVMDRSLVQGELVTASKAIIEKEYQPHVIVSTTG    491 - 560
PNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKSPPDQPAVPHPPPSTPIKLEEDLVPEPTTGD    561 - 630
DSDAATFKPTLPDLSPDEPSEALGFPMLEKEEEAHRPPSPTEAPTEASPEPAPDPAPVAEEAAPSAVEEG    631 - 700
AAADPGSDGSPGKSPSKKKKKFRTPSFLKKSKKKSDS                                     701 - 737
//

Text Mined References (209)

PMID Year Title
27349000 2016 Alpha Adducin G460T Variant is a Risk Factor for Hypertension in Tunisian Population.
27340988 2016 Angiotensin-Converting Enzyme (ACE) I/D and Alpha-Adducin (ADD1) G460W Gene Polymorphisms in Turkish Patients with Severe Chronic Tinnitus.
26042478 2015 Association of alpha-ADD1 Gene and Hypertension Risk: A Meta-Analysis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25816007 2015 A phosphorylation-related variant ADD1-rs4963 modifies the risk of colorectal cancer.
25567773 2015 The interactions between alcohol consumption and DNA methylation of the ADD1 gene promoter modulate essential hypertension susceptibility in a population-based, case-control study.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
25344630 2014 An ?2-Na/K ATPase/?-adducin complex in astrocytes triggers non-cell autonomous neurodegeneration.
25262176 2014 Gene polymorphisms of adducin GLY460TRP, ACE I/D, AND AGT M235T in pediatric hypertension patients.
24718403 2014 ?-Adducin gene G614T polymorphisms in essential hypertension patients with high low density lipoprotein (LDL) levels.
24711455 2014 Adducin is required for desmosomal cohesion in keratinocytes.
24379415 2014 Adducin-1 is essential for mitotic spindle assembly through its interaction with myosin-X.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23985264 2013 [A missense SNP in the codon of ADD1 phosphorylation site associated with non-cardia gastric cancer susceptibility in a Chinese population].
23863317 2013 Effects of ACE and ADD1 gene polymorphisms on blood pressure response to hydrochlorothiazide: a meta-analysis.
23691048 2013 Lower ADD1 gene promoter DNA methylation increases the risk of essential hypertension.
23540412 2013 ACE and ADD1 gene in extra and intracranial atherosclerosis in ischaemic stroke.
23509723 2013 Association between polymorphisms of alpha-adducin gene and essential hypertension in Chinese population.
23284854 2012 Hypertension-linked mutation of ?-adducin increases CFTR surface expression and activity in HEK and cultured rat distal convoluted tubule cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22810272 2013 Computational study of ADD1 gene polymorphism associated with hypertension.
22677360 2012 The Gly460Trp polymorphism of alpha-adducin gene as a predictor of renal function decline over 4 years of follow-up in an apparently healthy Chinese population.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22476228 2012 Association between genetic variants of the ADD1 and GNB3 genes and blood pressure response to the cold pressor test in a Chinese Han population: the GenSalt Study.
22307086 2012 A role for ?-adducin (ADD-1) in nematode and human memory.
22272309 2012 ?-Adducin Gly460Trp gene mutation and essential hypertension in a Chinese population: a meta-analysis including 10,960 subjects.
22198647 2012 Do ACE (rs4646994) and ?ADDUCIN (rs4961) gene polymorphisms predict the recurrence of hypertensive intracerebral hemorrhage?
22197999 2012 Enterohaemorrhagic Escherichia coli requires the spectrin cytoskeleton for efficient attachment and pedestal formation on host cells.
22163289 2011 Disruption of spectrin-like cytoskeleton in differentiating keratinocytes by PKC? activation is associated with phosphorylated adducin.
22117679 2011 [Polymorphism Gly460Trp of alpha-adducin gene and predisposition to essential hypertension. The role of gene-environment interactions in the development of the disease in Russian population].
21736685 2011 ?-Adducin translocates to the nucleus upon loss of cell-cell adhesions.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21364877 2011 Association of ?-adducin and G-protein ?3 genetic polymorphisms with hypertension: a meta-analysis of Chinese populations.
21339657 Angiotensin-converting enzyme (rs4646994) and ? ADDUCIN (rs4961) gene polymorphisms' study in primary spontaneous intracerebral hemorrhage.
21269460 2011 Initial characterization of the human central proteome.
21228790 2011 ?-adducin Gly460Trp polymorphism and essential hypertension risk in Chinese: a meta-analysis.
21194526 2011 A study of ACE and ADD1 polymorphism in ischemic and hemorrhagic stroke.
20929695 2010 The influence of ?-adducin gene polymorphism on response of blood pressure to exercise in patients with hypertension.
20927398 2010 Alpha-adducin Gly460Trp polymorphism and hypertension risk: a meta-analysis of 22 studies including 14303 cases and 15961 controls.
20877298 2012 The genetics of loop diuretic effects.
20838486 2010 Gly460Trp polymorphism of the ADD1 gene and essential hypertension in an Indian population: A meta-analysis on hypertension risk.
20810786 2010 Adducins regulate remodeling of apical junctions in human epithelial cells.
20667857 2011 Genetic risk factors for cerebral small-vessel disease in hypertensive patients from a genetically isolated population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20577119 2010 Pharmacogenetic association of hypertension candidate genes with fasting glucose in the GenHAT Study.
20565774 2010 Population based allele frequencies of disease associated polymorphisms in the Personalized Medicine Research Project.
20536507 2010 Independent predictive roles of eotaxin Ala23Thr, paraoxonase 2 Ser311Cys and beta-adrenergic receptor Trp64Arg polymorphisms on cardiac disease in Type 2 Diabetes--an 8-year prospective cohort analysis of 1297 patients.
20473689 2010 Polymorphisms in the GNB3 and ADD1 genes and blood pressure in a Chinese population.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20160191 2010 Genetic effects on carotid intima-media thickness: systematic assessment and meta-analyses of candidate gene polymorphisms studied in more than 5000 subjects.
20145305 2010 Association between alpha-adducin gene polymorphism (Gly460Trp) and genetic predisposition to salt sensitivity: a meta-analysis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19960031 2010 Lack of association between alpha-adducin G460W polymorphism and hypertension: evidence from a case-control study and a meta-analysis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19838659 2010 alpha- and beta-Adducin polymorphisms affect podocyte proteins and proteinuria in rodents and decline of renal function in human IgA nephropathy.
19779464 2009 Genetic factors are relevant and independent determinants of antihypertensive drug effects in a multiracial population.
19779330 2009 The influence of six cardiovascular polymorphisms on a first event of ischemic heart disease is modified by sex and age.
19729965 2009 Blood pressure-related genes and the progression of IgA nephropathy.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19620885 2009 Sex-specific effect of the alpha-adducin (G460W) and AGTR1 (A1166C) polymorphism on carotid intima-media thickness.
19574959 2009 Novel genetic variants in the alpha-adducin and guanine nucleotide binding protein beta-polypeptide 3 genes and salt sensitivity of blood pressure.
19567882 2009 Adducin forms a bridge between the erythrocyte membrane and its cytoskeleton and regulates membrane cohesion.
19559392 2009 A candidate gene association study of 77 polymorphisms in migraine.
19479237 2009 Phenotype-genotype interactions on renal function in type 2 diabetes: an analysis using structural equation modelling.
19443911 2009 Angiotensin-converting enzyme and adducin-1 polymorphisms in women with preeclampsia and gestational hypertension.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19274077 2009 Genetic polymorphisms and the risk of accelerated renal function decline in women.
19263529 2009 Genetic risk factors in recurrent venous thromboembolism: A multilocus, population-based, prospective approach.
19247266 2009 Variation in Renin-Angiotensin system and salt-sensitivity genes and the risk of diabetes mellitus associated with the use of thiazide diuretics.
19243623 2009 Analysis of renin-angiotensin aldosterone system gene polymorphisms in Malaysian essential hypertensive and type 2 diabetic subjects.
19242491 2009 The contribution of six polymorphisms to cardiovascular risk in a Dutch high-risk primary care population: the HIPPOCRATES project.
19238444 2009 The genomic basis of cerebral palsy: a HuGE systematic literature review.
19199261 2009 [Association of the polymorphisms of sodium transport related genes with essential hypertension].
19166692 2009 Usefulness of genetic polymorphisms and conventional risk factors to predict coronary heart disease in patients with familial hypercholesterolemia.
19148102 2009 Hypertension genes and retinal vascular calibre: the Cardiovascular Health Study.
19145770 2009 The association between arterial stiffness and the angiotensin II type 1 receptor (A1166C) polymorphism is influenced by the use of cardiovascular medication.
19145769 2009 Interaction between the Gly460Trp alpha-adducin gene variant and diuretics on the risk of myocardial infarction.
19131662 2009 A meta-analysis of candidate gene polymorphisms and ischemic stroke in 6 study populations: association of lymphotoxin-alpha in nonhypertensive patients.
19103106 2008 [Study on the association of predisposing genes with essential hypertension among Kazakhs ethnic group in Xinjiang].
19057513 2009 Renin-angiotensin system and alpha-adducin gene polymorphisms and their relation to responses to antihypertensive drugs: results from the GENRES study.
19047752 2008 Host alpha-adducin is redistributed and localized to the inclusion membrane in chlamydia- and chlamydophila-infected cells.
18977990 2008 Candidate genes and cerebral palsy: a population-based study.
18800139 2009 Arterial properties in relation to genetic variation in alpha-adducin and the renin-angiotensin system in a White population.
18787518 2009 Arterial properties in relation to genetic variations in the adducin subunits in a white population.
18679149 2008 Single nucleotide polymorphisms in genes of circulatory homeostasis in surviving pediatric intensive care patients with meningococcal infection.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18667944 2008 Gly460Trp alpha-adducin mutation as a possible mechanism leading to endolymphatic hydrops in Ménière's syndrome.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18657677 2008 Alpha-adducin polymorphism associated with increased risk of adverse cardiovascular outcomes: results from GENEtic Substudy of the INternational VErapamil SR-trandolapril STudy (INVEST-GENES).
18591455 2008 Physiological interaction between alpha-adducin and WNK1-NEDD4L pathways on sodium-related blood pressure regulation.
18524856 2008 alpha-Adducin mutations increase Na/K pump activity in renal cells by affecting constitutive endocytosis: implications for tubular Na reabsorption.
18513389 2008 New application of intelligent agents in sporadic amyotrophic lateral sclerosis identifies unexpected specific genetic background.
18475162 2008 Effects of genetic variation in adducin on left ventricular diastolic function as assessed by tissue Doppler imaging in a Flemish population.
18458162 2008 Alpha-adducin Gly460Trp variant increases the risk of stroke in hypertensive Dutch women.
18413308 2008 Gene-load score of the renin-angiotensin-aldosterone system is associated with coronary heart disease in familial hypercholesterolaemia.
18398333 2008 Relationships among endogenous ouabain, alpha-adducin polymorphisms and renal sodium handling in primary hypertension.
18393230 2008 [Association of alpha-adducin and angiotensin converting enzyme gene polymorphisms with salt-sensitive hypertension and early renal injury].
18088087 2008 Phosphoproteome of resting human platelets.
18003973 2008 Adducin promotes micrometer-scale organization of beta2-spectrin in lateral membranes of bronchial epithelial cells.
17984662 2007 Association of alpha-adducin Gly460Trp polymorphism with coronary artery disease in a Korean population.
17921817 2007 Gly460Trp alpha-adducin gene polymorphism and endothelial function in untreated hypertensive patients.
17825147 2007 [Association of alpha-adducin gene and G-protein beta3-subunit gene with essential hypertension in Chinese].
17765140 2007 Association between adducin-1 G460W variant and blood pressure in Swedes is dependent on interaction with body mass index and gender.
17472579 2007 The alpha-adducin Gly460Trp polymorphism and the antihypertensive effects of exercise among men with high blood pressure.
17452507 2007 Angiotensin-converting enzyme I/D and alpha-adducin Gly460Trp polymorphisms: from angiotensin-converting enzyme activity to cardiovascular outcome.
17301826 2007 Intra-erythrocyte cation concentrations in relation to the C1797T beta-adducin polymorphism in a general population.
17267840 2007 Genetic polymorphisms and spontaneous preterm birth.
17215849 2007 Both angiotensinogen M235T and alpha-adducin G460W polymorphisms are associated with hypertension in the Japanese population.
17189961 2007 Diuretic-gene interaction and the risk of myocardial infarction and stroke.
17083073 2006 Renal haemodynamics are not related to genotypes in offspring of parents with essential hypertension.
17082469 2006 Alpha-adducin polymorphism, atherosclerosis, and cardiovascular and cerebrovascular risk.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17051589 2006 Selected gene polymorphisms and their interaction with maternal smoking, as risk factors for gastroschisis.
17003363 2006 The alpha-adducin gene is associated with macrovascular complications and mortality in patients with type 2 diabetes.
16970091 2006 [Relationship between the polymorphism of alpha-adducin gene and the two phenotypes of constitutions in patients with essential hypertension classified by TCM].
16724011 2006 The influence of the alpha-adducin G460W polymorphism and angiotensinogen M235T polymorphism on antihypertensive medication and blood pressure.
16702981 2007 Antihypertensive therapy, the alpha-adducin polymorphism, and cardiovascular disease in high-risk hypertensive persons: the Genetics of Hypertension-Associated Treatment Study.
16615274 2006 [Association analysis of the essential hypertension susceptibility genes in adolescents: Kangwha study].
16612256 2006 Alpha-adducin and angiotensin-converting enzyme polymorphisms in hypertension: evidence for a joint influence on albuminuria.
16531798 2006 The 460Trp allele of alpha-adducin increases carotid intima-media thickness in young adult males.
16497648 2006 Polymorphisms in four candidate genes in young patients with essential hypertension.
16450155 2006 Hydrochlorothiazide efficacy and polymorphisms in ACE, ADD1 and GNB3 in healthy, male volunteers.
16420563 2006 Multi-locus candidate gene polymorphisms and risk of myocardial infarction: a population-based, prospective genetic analysis.
16392768 2005 Combined analysis of polymorphisms in angiotensinogen and adducin genes and their effects on hypertension in a Japanese sample: The Shigaraki Study.
16314886 Interactions between five candidate genes and antihypertensive drug therapy on blood pressure.
16289097 2005 RFX-1, a putative alpha Adducin interacting protein in a human kidney library.
16266470 2005 [Association of polymorphism in alpha-adducin gene with antihypertensive effect of Hydrochlorothiazide].
16100725 2005 Risks of human conotruncal heart defects associated with 32 single nucleotide polymorphisms of selected cardiovascular disease-related genes.
16080807 2005 [Association of peripheral and central blood pressure with the alpha-adducin Gly460Trp polymorphism in a Chinese population].
16043664 2005 Cardiovascular risk in relation to alpha-adducin Gly460Trp polymorphism and systolic pressure: a prospective population study.
15910744 2005 Rho-kinase induces association of adducin with the cytoskeleton in platelet activation.
15834281 2005 Epistatic interaction between alpha- and gamma-adducin influences peripheral and central pulse pressures in white Europeans.
15824464 2004 The thiazide-sensitive Na(+)-Cl(-) cotransporter gene, C1784T, and adrenergic receptor-beta3 gene, T727C, may be gene polymorphisms susceptible to the antihypertensive effect of thiazide diuretics.
15822905 Phosphoproteomic analysis of synaptosomes from human cerebral cortex.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15773232 2005 Associations of baseline blood pressure levels and efficacy of Benazepril treatment with interaction of alpha-adducin and ACE gene polymorphisms in hypertensives.
15716695 2005 Role of the adducin family genes in human essential hypertension.
15608390 2004 Alpha-adducin Gly460Trp polymorphism and essential hypertension in Korea.
15554870 2005 Sodium-lithium countertransport and the Gly460-->Trp alpha-adducin polymorphism in essential hypertension.
15493144 2004 Significant associations of the alpha-adducin gene Gly460Trp polymorphism with serum bilirubin concentrations in Chinese essential hypertension patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15378162 2004 Renal function in relation to three candidate genes in a Chinese population.
15326084 2004 Alpha-adducin Gly460Trp polymorphism and renal hemodynamics in essential hypertension.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15187197 2004 Role of alpha-adducin DNA polymorphisms in the genetic predisposition to diabetic nephropathy.
15110895 2004 Alpha-adducin G460W polymorphism, urinary sodium excretion, and blood pressure in community-based samples.
15097233 2004 Blood pressure in relation to three candidate genes in a Chinese population.
15059531 2004 [Alpha-adducin gene G/W460 polymorphism is associated with intracerebral hemorrhage in Chinese].
15055253 2004 Association between hypertension and the alpha-adducin, beta1-adrenoreceptor, and G-protein beta3 subunit genes in the Japanese population; the Suita study.
15039125 2004 Genotypes and haplotypes predisposing to myocardial infarction: a multilocus case-control study.
14733918 2004 Screening of Hsp105alpha-binding proteins using yeast and bacterial two-hybrid systems.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14643575 2003 Alpha-adducin polymorphism, salt sensitivity, nitric oxide excretion, and cardiovascular risk factors in normotensive Hispanics.
14553962 2003 Effects of endothelial nitric oxide synthase, alpha-adducin, and other candidate gene polymorphisms on blood pressure response to hydrochlorothiazide.
14530292 2003 Genetic determinants of nonmodulating hypertension.
14508192 2003 Alpha-adducin gene polymorphism is associated with essential hypertension in Chinese: a case-control and family-based study.
13679477 2003 Influence of ACE (I/D) and G460W polymorphism of alpha-adducin in autosomal dominant polycystic kidney disease.
12885793 2003 Interaction between ACE and ADD1 gene polymorphisms in the progression of IgA nephropathy in Japanese patients.
12697976 2003 Influence of the alpha-adducin and ACE gene polymorphism on the progression of autosomal-dominant polycystic kidney disease.
12623934 2003 ACE and alpha-adducin polymorphism as markers of individual response to diuretic therapy.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427140 2002 Association between hypertension and variation in the alpha- and beta-adducin genes in a white population.
12394950 2002 Angiotensin converting enzyme DD genotype is associated with hypertensive crisis.
12195119 2002 alpha-Adducin Gly460Trp polymorphism is associated with low renin hypertension in younger subjects in the Ohasama study.
12195118 2002 alpha-Adducin Gly460Trp polymorphism, left ventricular mass and plasma renin activity.
12172317 2002 Carotid and femoral intima-media thickness in relation to three candidate genes in a Caucasian population.
12107410 2002 Expressed sequence tag analysis of human RPE/choroid for the NEIBank Project: over 6000 non-redundant transcripts, novel genes and splice variants.
12107246 2002 Blood pressure in patients with primary aldosteronism is influenced by bradykinin B(2) receptor and alpha-adducin gene polymorphisms.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12052841 2002 ADD1 460W allele associated with cardiovascular disease in hypertensive individuals.
11918988 2002 D(2) dopamine receptor (DRD2) polymorphism is associated with severity of alcohol dependence.
11918733 2002 Role of the alpha-adducin genotype on renal disease progression.
11882573 2002 alpha-Adducin 460Trp allele is associated with erythrocyte Na transport rate in North Sardinian primary hypertensives.
11847182 2002 Low-renin hypertension, altered sodium homeostasis, and an alpha-adducin polymorphism.
11775124 2001 Association between the alpha-adducin Gly460Trp polymorphism and systolic blood pressure in familial combined hyperlipidemia.
11728946 2001 Renal function in relation to three candidate genes.
11711521 2001 Carotid and femoral artery stiffness in relation to three candidate genes in a white population.
11528213 2001 Lack of association between Gly460Trp polymorphism of alpha-adducin gene and salt sensitivity of blood pressure in Polish hypertensives.
11518842 2001 Effects of three candidate genes on prevalence and incidence of hypertension in a Caucasian population.
11447495 Association study of eight candidate genes with renin status in mild-to-moderate hypertension in patients of African ancestry.
11283377 2001 G-protein beta3 subunit and alpha-adducin polymorphisms and risk of subclinical and clinical stroke.
11116113 2000 alpha-adducin and angiotensin I-converting enzyme polymorphisms in essential hypertension.
11110979 2000 [Is Gly460Trp variant of alpha-adducin associated with essential hypertension in the Hans of Chinese population].
10950304 2000 Adducin: structure, function and regulation.
10823823 2000 Cleavage of the actin-capping protein alpha -adducin at Asp-Asp-Ser-Asp633-Ala by caspase-3 is preceded by its phosphorylation on serine 726 in cisplatin-induced apoptosis of renal epithelial cells.
10585876 1999 Functional antagonism between inhibitor of DNA binding (Id) and adipocyte determination and differentiation factor 1/sterol regulatory element-binding protein-1c (ADD1/SREBP-1c) trans-factors for the regulation of fatty acid synthase promoter in adipocytes.
10516168 1999 Evidence for an interaction between adducin and Na(+)-K(+)-ATPase: relation to genetic hypertension.
10391210 1999 Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis.
10209029 1999 Phosphorylation of adducin by Rho-kinase plays a crucial role in cell motility.
9679146 1998 Adducin is an in vivo substrate for protein kinase C: phosphorylation in the MARCKS-related domain inhibits activity in promoting spectrin-actin complexes and occurs in many cells, including dendritic spines of neurons.
9674650 1998 Human alpha-adducin gene, blood pressure, and sodium metabolism.
9149697 1997 Polymorphisms of alpha-adducin and salt sensitivity in patients with essential hypertension.
8946164 1996 Transcript map of the human chromosome 4p16.3 consisting of 627 cDNA clones derived from 1 Mb of the Huntington's disease locus.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8810272 1996 Adducin regulation. Definition of the calmodulin-binding domain and sites of phosphorylation by protein kinases A and C.
8663089 1996 Identification of the spectrin subunit and domains required for formation of spectrin/adducin/actin complexes.
8626479 1996 A new function for adducin. Calcium/calmodulin-regulated capping of the barbed ends of actin filaments.
7959767 1994 The murine homologues of the Huntington disease gene (Hdh) and the alpha-adducin gene (Add1) map to mouse chromosome 5 within a region of conserved synteny with human chromosome 4p16.3.
7774961 1995 Genomic organization of the human alpha-adducin gene and its alternately spliced isoforms.
7642559 1995 Adducin: a physical model with implications for function in assembly of spectrin-actin complexes.
7490111 1995 Assignment of the human beta-adducin gene (ADD2) to 2p13-p14 by in situ hybridization.
3693401 1987 Erythrocyte adducin: a calmodulin-regulated actin-bundling protein that stimulates spectrin-actin binding.
3600811 1987 Modulation of spectrin-actin assembly by erythrocyte adducin.
2976282 1988 Interaction of biological membranes with the cytoskeletal framework of living cells.
1840603 1991 Primary structure and domain organization of human alpha and beta adducin.
1345173 1992 Cloning of the alpha-adducin gene from the Huntington's disease candidate region of chromosome 4 by exon amplification.
1284592 1992 Cloning and mapping of the alpha-adducin gene close to D4S95 and assessment of its relationship to Huntington disease.