Property Summary

NCBI Gene PubMed Count 18
PubMed Score 107.56
PubTator Score 44.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -2.300 2.9e-02
breast carcinoma -1.500 1.2e-04
interstitial cystitis 1.100 1.0e-04
invasive ductal carcinoma -1.300 1.7e-03
lung adenocarcinoma -1.100 2.4e-14
lung carcinoma -1.400 1.9e-07
non-small cell lung cancer -1.407 1.6e-25
osteosarcoma -2.868 2.4e-05

 MGI Phenotype (1)

Gene RIF (8)

AA Sequence

MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPSFLTTVLCALG      1 - 70
GFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQVSYFLFVIFTAYAMLPLGMRD     71 - 140
AAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVLFLCGNVAGVYHKALMERALRATFREALSSL    141 - 210
HSRRRLDTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIV    211 - 280
GFTRLASECSPKELVLMLNELFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCR    281 - 350
AIRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG    351 - 420
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTRYLESWGAAKP    421 - 490
FAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAKFFQVIEQLNSQKQWKQSKDF    491 - 560
NPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFIIQMLVTNRPPALAITYSITFLLFLLILFVC    561 - 630
FSEDLMRCVLKGPKMLHWLPALSGLVATRPGLRIALGTATILLVFAMAITSLFFFPTSSDCPFQAPNVSS    631 - 700
MISNLSWELPGSLPLISVPYSMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLI    701 - 770
VRLYLGPLDSRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL    771 - 840
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNEIIADFD    841 - 910
ELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMVEFAVALGSKLDVINKHSFNN    911 - 980
FRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMESTGVLGKIQVTEETAWALQSLGYTCYSRGVIK    981 - 1050
VKGKGQLCTYFLNTDLTRTGPPSATLG                                              1051 - 1077
//

Text Mined References (19)

PMID Year Title