Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.37
PubTator Score 3.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma 1.498 3.4e-05
adult high grade glioma 1.800 1.9e-05
astrocytic glioma 1.400 1.2e-02
Astrocytoma, Pilocytic 1.200 1.6e-05
atypical teratoid / rhabdoid tumor 2.600 6.0e-06
Breast cancer 1.300 1.6e-08
ependymoma 1.600 2.8e-05
glioblastoma 1.700 4.7e-06
Hydrolethalus syndrome 1.132 3.9e-02
interstitial cystitis 1.500 1.2e-03
intraductal papillary-mucinous neoplasm ... 1.300 4.4e-03
lung cancer 4.300 8.2e-07
medulloblastoma 1.400 2.6e-02
oligodendroglioma 1.300 9.3e-03
primitive neuroectodermal tumor 1.500 1.1e-03

Gene RIF (4)

AA Sequence

MEILWKTLTWILSLIMASSEFHSDHRLSYSSQEEFLTYLEHYQLTIPIRVDQNGAFLSFTVKNDKHSRRR      1 - 70
RSMDPIDPQQAVSKLFFKLSAYGKHFHLNLTLNTDFVSKHFTVEYWGKDGPQWKHDFLDNCHYTGYLQDQ     71 - 140
RSTTKVALSNCVGLHGVIATEDEEYFIEPLKNTTEDSKHFSYENGHPHVIYKKSALQQRHLYDHSHCGVS    141 - 210
DFTRSGKPWWLNDTSTVSYSLPINNTHIHHRQKRSVSIERFVETLVVADKMMVGYHGRKDIEHYILSVMN    211 - 280
IVAKLYRDSSLGNVVNIIVARLIVLTEDQPNLEINHHADKSLDSFCKWQKSILSHQSDGNTIPENGIAHH    281 - 350
DNAVLITRYDICTYKNKPCGTLGLASVAGMCEPERSCSINEDIGLGSAFTIAHEIGHNFGMNHDGIGNSC    351 - 420
GTKGHEAAKLMAAHITANTNPFSWSACSRDYITSFLDSGRGTCLDNEPPKRDFLYPAVAPGQVYDADEQC    421 - 490
RFQYGATSRQCKYGEVCRELWCLSKSNRCVTNSIPAAEGTLCQTGNIEKGWCYQGDCVPFGTWPQSIDGG    491 - 560
WGPWSLWGECSRTCGGGVSSSLRHCDSPAPSGGGKYCLGERKRYRSCNTDPCPLGSRDFREKQCADFDNM    561 - 630
PFRGKYYNWKPYTGGGVKPCALNCLAEGYNFYTERAPAVIDGTQCNADSLDICINGECKHVGCDNILGSD    631 - 700
AREDRCRVCGGDGSTCDAIEGFFNDSLPRGGYMEVVQIPRGSVHIEVREVAMSKNYIALKSEGDDYYING    701 - 770
AWTIDWPRKFDVAGTAFHYKRPTDEPESLEALGPTSENLIVMVLLQEQNLGIRYKFNVPITRTGSGDNEV    771 - 840
GFTWNHQPWSECSATCAGGVQRQEVVCKRLDDNSIVQNNYCDPDSKPPENQRACNTEPCPPEWFIGDWLE    841 - 910
CSKTCDGGMRTRAVLCIRKIGPSEEETLDYSGCLTHRPVEKEPCNNQSCPPQWVALDWSECTPKCGPGFK    911 - 980
HRIVLCKSSDLSKTFPAAQCPEESKPPVRIRCSLGRCPPPRWVTGDWGQCSAQCGLGQQMRTVQCLSYTG    981 - 1050
QASSDCLETVRPPSMQQCESKCDSTPISNTEECKDVNKVAYCPLVLKFKFCSRAYFRQMCCKTCQGH      1051 - 1117
//

Text Mined References (16)

PMID Year Title