Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.12
PubTator Score 10.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6685 4.9e-17
posterior fossa group A ependymoma 1511 2.4e-06
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Breast cancer 3098 0.0 1.0

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group A ependymoma 1.800 2.4e-06
psoriasis -2.100 4.9e-17

Gene RIF (7)

PMID Text
24366283 Epistasis between single nucleotide polymorphisms within the TSHB and ADAMTS16 genes may increase the risk of premature ovarian failure in Korean women.
22562232 Data show that the expression of ADAMTS4, 9, 16 and was up-regulated during chondrogenesis, ADAMTS1 and 5 were down-regulated.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19635554 Results describe the distribution, regulation and function of human ADAMTS-16.
19423552 Blood pressure is associated with SNPs of ADAMTS16 in human.
17519324 These studies provide the first evidence that ADAMTS-16 is an active protease and suggest a physiological role of ADAMTS-16 in ovarian follicles, at least during the pre-ovulatory phase.
16507336 comparison of the effects of C-terminal truncation on the GAG-binding properties and aggrecanase activity of ADAMTS-5 relative to three other ADAMTS family members, ADAMTS-9, ADAMTS-16 and ADAMTS-18

AA Sequence

MKPRARGWRGLAALWMLLAQVAEQAPACAMGPAAAAPGSPSVPRPPPPAERPGWMEKGEYDLVSAYEVDH      1 - 70
RGDYVSHEIMHHQRRRRAVPVSEVESLHLRLKGSRHDFHMDLRTSSSLVAPGFIVQTLGKTGTKSVQTLP     71 - 140
PEDFCFYQGSLRSHRNSSVALSTCQGLSGMIRTEEADYFLRPLPSHLSWKLGRAAQGSSPSHVLYKRSTE    141 - 210
PHAPGASEVLVTSRTWELAHQPLHSSDLRLGLPQKQHFCGRRKKYMPQPPKEDLFILPDEYKSCLRHKRS    211 - 280
LLRSHRNEELNVETLVVVDKKMMQNHGHENITTYVLTILNMVSALFKDGTIGGNINIAIVGLILLEDEQP    281 - 350
GLVISHHADHTLSSFCQWQSGLMGKDGTRHDHAILLTGLDICSWKNEPCDTLGFAPISGMCSKYRSCTIN    351 - 420
EDTGLGLAFTIAHESGHNFGMIHDGEGNMCKKSEGNIMSPTLAGRNGVFSWSPCSRQYLHKFLSTAQAIC    421 - 490
LADQPKPVKEYKYPEKLPGELYDANTQCKWQFGEKAKLCMLDFKKDICKALWCHRIGRKCETKFMPAAEG    491 - 560
TICGHDMWCRGGQCVKYGDEGPKPTHGHWSDWSSWSPCSRTCGGGVSHRSRLCTNPKPSHGGKFCEGSTR    561 - 630
TLKLCNSQKCPRDSVDFRAAQCAEHNSRRFRGRHYKWKPYTQVEDQDLCKLYCIAEGFDFFFSLSNKVKD    631 - 700
GTPCSEDSRNVCIDGICERVGCDNVLGSDAVEDVCGVCNGNNSACTIHRGLYTKHHHTNQYYHMVTIPSG    701 - 770
ARSIRIYEMNVSTSYISVRNALRRYYLNGHWTVDWPGRYKFSGTTFDYRRSYNEPENLIATGPTNETLIV    771 - 840
ELLFQGRNPGVAWEYSMPRLGTEKQPPAQPSYTWAIVRSECSVSCGGGQMTVREGCYRDLKFQVNMSFCN    841 - 910
PKTRPVTGLVPCKVSACPPSWSVGNWSACSRTCGGGAQSRPVQCTRRVHYDSEPVPASLCPQPAPSSRQA    911 - 980
CNSQSCPPAWSAGPWAECSHTCGKGWRKRAVACKSTNPSARAQLLPDAVCTSEPKPRMHEACLLQRCHKP    981 - 1050
KKLQWLVSAWSQCSVTCERGTQKRFLKCAEKYVSGKYRELASKKCSHLPKPSLELERACAPLPCPRHPPF   1051 - 1120
AAAGPSRGSWFASPWSQCTASCGGGVQTRSVQCLAGGRPASGCLLHQKPSASLACNTHFCPIAEKKDAFC   1121 - 1190
KDYFHWCYLVPQHGMCSHKFYGKQCCKTCSKSNL                                       1191 - 1224
//

Text Mined References (15)

PMID Year Title
27156333 2016 The Investigation of a Disintegrin and Metalloproteinase with ThromboSpondin Motifs (ADAMTS) 1, 5 and 16 in Thoracic Aortic Aneurysms and Dissections.
26382559 2016 Evaluation of ADAMTS12, ADAMTS16, ADAMTS18 and IL-33 serum levels in pre-eclampsia.
24366283 2014 Epistasis between polymorphisms in TSHB and ADAMTS16 is associated with premature ovarian failure.
24039173 2013 Genetic predictors of risk and resilience in psychiatric disorders: a cross-disorder genome-wide association study of functional impairment in major depressive disorder, bipolar disorder, and schizophrenia.
23468962 2013 A genome-wide scan for breast cancer risk haplotypes among African American women.
22562232 2012 Regulation of aggrecanases from the ADAMTS family and aggrecan neoepitope formation during in vitro chondrogenesis of human mesenchymal stem cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19635554 2009 Characterization and regulation of ADAMTS-16.
19423552 2009 Positional identification of variants of Adamts16 linked to inherited hypertension.
17519324 2007 FSH stimulates the expression of the ADAMTS-16 protease in mature human ovarian follicles.
16507336 2006 Glycosaminoglycan-binding properties and aggrecanase activities of truncated ADAMTSs: comparative analyses with ADAMTS-5, -9, -16 and -18.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11867212 2002 Cloning, expression analysis, and structural characterization of seven novel human ADAMTSs, a family of metalloproteinases with disintegrin and thrombospondin-1 domains.
2618185 1989 [Photochemotherapy of experimental tumors in animals using various photosensitizers].