Property Summary

Ligand Count 6
NCBI Gene PubMed Count 180
PubMed Score 214.06
PubTator Score 226.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (29)

Disease log2 FC p
Breast cancer 3.700 2.2e-02
adrenocortical carcinoma 1.297 3.7e-02
adult high grade glioma 1.400 9.0e-06
Astrocytoma, Pilocytic 1.800 1.5e-05
atypical teratoid / rhabdoid tumor 1.100 8.3e-03
breast carcinoma 1.200 1.4e-07
cutaneous lupus erythematosus 1.200 5.7e-03
ductal carcinoma in situ 2.200 2.2e-02
Endometriosis 2.532 3.5e-02
ependymoma 1.200 1.1e-04
glioblastoma 2.000 4.9e-06
group 3 medulloblastoma 1.500 2.1e-02
interstitial cystitis 1.700 3.8e-04
interstitial lung disease 1.300 4.1e-02
invasive ductal carcinoma 1.100 4.6e-02
lung adenocarcinoma 1.700 5.8e-13
lung cancer 1.200 7.0e-03
malignant mesothelioma -2.900 1.1e-08
medulloblastoma, large-cell 1.100 4.9e-03
non-small cell lung cancer 2.247 2.0e-19
osteosarcoma 3.122 1.2e-03
ovarian cancer 1.900 1.5e-02
pancreatic cancer 1.100 2.9e-02
primary pancreatic ductal adenocarcinoma -1.209 1.6e-02
primary Sjogren syndrome 1.200 9.6e-04
primitive neuroectodermal tumor 1.700 4.4e-02
psoriasis 1.200 4.8e-31
ulcerative colitis 1.300 2.5e-02
X-linked cerebral adrenoleukodystrophy 1.700 3.2e-02

 CSPA Cell Line (2)

Gene RIF (126)

AA Sequence

MAARPLPVSPARALLLALAGALLAPCEARGVSLWNQGRADEVVSASVGSGDLWIPVKSFDSKNHPEVLNI      1 - 70
RLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLARNYTVILGHCYYHGHVRGYSDSAVSLSTCSG     71 - 140
LRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGSCGSHHNTPNLAAKNVFPPPSQTWARRHKRETL    141 - 210
KATKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDMDKCSVSQDPF    211 - 280
TSLHEFLDWRKMKLLPRKSHDNAQLVSGVYFQGTTIGMAPIMSMCTADQSGGIVMDHSDNPLGAAVTLAH    281 - 350
ELGHNFGMNHDTLDRGCSCQMAVEKGGCIMNASTGYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRE    351 - 420
SFGGQKCGNRFVEEGEECDCGEPEECMNRCCNATTCTLKPDAVCAHGLCCEDCQLKPAGTACRDSSNSCD    421 - 490
LPEFCTGASPHCPANVYLHDGHSCQDVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYG    491 - 560
NCGKVSKSSFAKCEMRDAKCGKIQCQGGASRPVIGTNAVSIETNIPLQQGGRILCRGTHVYLGDDMPDPG    561 - 630
LVLAGTKCADGKICLNRQCQNISVFGVHECAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGP    631 - 700
IRQADNQGLTIGILVTILCLLAAGFVVYLKRKTLIRLLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGH    701 - 770
LGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLNGLNVPQPQSTQRVLPPLHRAPRAPSVPARPLPAKP    771 - 840
ALRQAQGTCKPNPPQKPLPADPLARTTRLTHALARTPGQWETGLRLAPLRPAPQYPHQVPRSTHTAYIK     841 - 909
//

Text Mined References (184)

PMID Year Title