Property Summary

NCBI Gene PubMed Count 81
PubMed Score 78.46
PubTator Score 154.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (27)

Disease log2 FC p
acute quadriplegic myopathy 1.012 5.5e-03
Alzheimer's disease -1.100 1.9e-02
astrocytic glioma 1.100 1.9e-02
axial spondyloarthropathy 1.600 4.6e-02
Breast cancer 2.100 4.8e-02
breast carcinoma 1.100 6.2e-03
dermatomyositis 1.300 3.0e-03
ductal carcinoma in situ 1.100 6.7e-03
ependymoma 1.100 4.7e-03
group 4 medulloblastoma 1.300 1.2e-02
hereditary spastic paraplegia -1.268 1.1e-02
intraductal papillary-mucinous adenoma (... 1.200 4.8e-02
intraductal papillary-mucinous carcinoma... 1.300 2.0e-02
juvenile dermatomyositis 1.095 4.2e-06
lung adenocarcinoma 1.374 9.1e-08
oligodendroglioma 1.300 9.6e-04
osteosarcoma 1.885 1.4e-03
ovarian cancer -1.400 5.8e-04
pancreatic cancer -1.300 1.3e-02
pancreatic carcinoma -1.300 1.3e-02
Parkinson's disease -1.400 1.7e-02
Pick disease -1.100 2.7e-05
primary pancreatic ductal adenocarcinoma 1.392 7.8e-03
primary Sjogren syndrome 2.000 5.7e-05
progressive supranuclear palsy -1.300 5.3e-03
psoriasis 1.100 4.6e-04
Waldenstrons macroglobulinemia 1.583 1.1e-02

 MGI Phenotype (1)

Gene RIF (44)

AA Sequence

MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDEASELRSMLEV      1 - 70
NYPMENGIVRNWDDMKHLWDYTFGPEKLNIDTRNCKILLTEPPMNPTKNREKIVEVMFETYQFSGVYVAI     71 - 140
QAVLTLYAQGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKLLLLRGYAFNHSADF    141 - 210
ETVRMIKEKLCYVGYNIEQEQKLALETTVLVESYTLPDGRIIKVGGERFEAPEALFQPHLINVEGVGVAE    211 - 280
LLFNTIQAADIDTRSEFYKHIVLSGGSTMYPGLPSRLERELKQLYLERVLKGDVEKLSKFKIRIEDPPRR    281 - 350
KHMVFLGGAVLADIMKDKDNFWMTRQEYQEKGVRVLEKLGVTVR                              351 - 394
//

Text Mined References (88)

PMID Year Title