Property Summary

NCBI Gene PubMed Count 22
PubMed Score 6.22
PubTator Score 5.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.900 5.7e-03
ependymoma -3.200 3.2e-16
glioblastoma -2.700 2.8e-05
atypical teratoid / rhabdoid tumor -3.500 6.2e-07
adult high grade glioma -2.700 4.3e-04
group 4 medulloblastoma 1.500 4.3e-03
pilocytic astrocytoma -2.700 2.4e-08
subependymal giant cell astrocytoma -3.034 5.3e-03
lung carcinoma 2.600 7.1e-54
Pick disease -1.700 6.7e-03

Gene RIF (5)

PMID Text
26077106 we identified BAF53b as a neuron-specific subunit of the chromatin remodeling BAF complexes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19460752 Knockdown of actin-like 6B (ACTL6B; BAF53B) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
12565893 Data suggest that SWI/SNF complexes containing ArpN alpha might regulate certain genes involved in brain development and/or its function differently from SWI/SNF complexes containing ArpN beta/BAF53.

AA Sequence

MSGGVYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLLAAEEGGGLELEGDKEKKGKIFHIDTN      1 - 70
ALHVPRDGAEVMSPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEAPWNTRAKREKLTELMFEQ     71 - 140
YNIPAFFLCKTAVLTAFANGRSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFISMQCRELFQEM    141 - 210
AIDIIPPYMIAAKEPVREGAPPNWKKKEKLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVAAQMP    211 - 280
TVHYEMPNGYNTDYGAERLRIPEGLFDPSNVKGLSGNTMLGVGHVVTTSIGMCDIDIRPGLYGSVIVTGG    281 - 350
NTLLQGFTDRLNRELSQKTPPSMRLKLIASNSTMERKFSPWIGGSILASLGTFQQMWISKQEYEEGGKQC    351 - 420
VERKCP                                                                    421 - 426
//

Text Mined References (23)

PMID Year Title
26077106 2015 Generation of BAF53b-Cre transgenic mice with pan-neuronal Cre activities.
25838002 2015 Toward understanding the role of the neuron-specific BAF chromatin remodeling complex in memory formation.
23525042 2013 The neuron-specific chromatin regulatory subunit BAF53b is necessary for synaptic plasticity and memory.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12565893 2003 The brain-specific actin-related protein ArpN alpha interacts with the transcriptional co-repressor CtBP.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437990 2002 Brain-specific expression of the nuclear actin-related protein ArpNalpha and its involvement in mammalian SWI/SNF chromatin remodeling complex.
12368262 2002 Identification of a polymorphic, neuron-specific chromatin remodeling complex.
11726552 2001 Fanconi anemia protein, FANCA, associates with BRG1, a component of the human SWI/SNF complex.
10611965 1999 Actin-related proteins.
10380635 1999 Two isoforms of a human actin-related protein show nuclear localization and mutually selective expression between brain and other tissues.
9847074 1998 Toward a complete human genome sequence.
9799793 1998 Large-scale sequencing of two regions in human chromosome 7q22: analysis of 650 kb of genomic sequence around the EPO and CUTL1 loci reveals 17 genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8804307 1996 Diversity and specialization of mammalian SWI/SNF complexes.