Property Summary

NCBI Gene PubMed Count 44
PubMed Score 24.05
PubTator Score 22.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
gastric cancer 1.100 1.5e-03
hepatocellular carcinoma 1.300 7.5e-06
malignant mesothelioma 1.400 2.0e-04
psoriasis 1.600 8.4e-04
astrocytoma 1.800 3.7e-25
glioblastoma 2.500 1.7e-07
oligodendroglioma 1.800 4.8e-16
osteosarcoma 1.055 3.8e-02
posterior fossa group A ependymoma 2.200 1.7e-12
sonic hedgehog group medulloblastoma 2.900 7.9e-08
atypical teratoid / rhabdoid tumor 2.600 5.0e-10
medulloblastoma, large-cell 3.000 1.0e-06
primitive neuroectodermal tumor 2.500 6.0e-07
non-small cell lung cancer 1.624 4.4e-22
lung cancer 2.000 1.2e-03
pediatric high grade glioma 2.400 1.6e-08
pilocytic astrocytoma 1.600 3.2e-06
lung adenocarcinoma 1.101 2.3e-04
acute myeloid leukemia -2.100 2.9e-02
ovarian cancer 1.200 2.0e-02
Breast cancer 1.100 9.0e-05

Gene RIF (11)

PMID Text
26698646 ACTL6A protein expression predicts poor prognosis of hepatocellular carcinoma and metastasis.
26242195 BAF53 is prerequisite for maintaining the structural integrity of chromosomal subdomains.
23728344 These results indicate that failure to downregulate the BAF53a subunit may contribute to the pathogenesis of rhabdomyosarcoma, and suggest that BAF53a may represent a novel therapeutic target for this tumor.
23395444 Data show that ACTL6a prevents SWI/SNF complex binding to promoters of KLF4 and other differentiation genes and that SWI/SNF catalytic subunits are required for full induction of KLF4 targets.
22573825 The beta-actin-Arp4 complex formation might be a crucial feature in some chromatin-modifying enzyme complexes, such as the Brg1 complex.
21821000 These results suggest that activated expression of the E6 and E7 genes of integrated HPV is dependent on BAF53-dependent higher-order chromatin structure or nuclear motor activity.
21699904 study finds Baf53 and Baf170 are highly regulated in HIV-1-infected cells;innate function of Baf53-containing complexes appears to be transcriptionally suppressive
21699904 HIV-1 Tat-activated transcription induces phosphorylation of Baf53
19716452 HIV-1 Tat-activated transcription induces phosphorylation of Baf53
19454010 HIV-1 Tat-activated transcription induces phosphorylation of Baf53
14503849 data show that BAF53 shuttles between the cytoplasm and nucleus in an energy-dependent manner, and suggest that BAF53 can play a role distinct from its previously recognized function in transcriptional regulation

AA Sequence

MSGGVYGGDEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVERDDGSTLMEIDGDKGKQGGPTYYI      1 - 70
DTNALRVPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAPWNTRAKREKLTELM     71 - 140
FEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATHTTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELF    141 - 210
QEMNIELVPPYMIASKEAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDEQVAA    211 - 280
QMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVSHVVTTSVGMCDIDIRPGLYGSVIV    281 - 350
AGGNTLIQSFTDRLNRELSQKTPPSMRLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGG    351 - 420
KQCVERKCP                                                                 421 - 429
//

Text Mined References (51)

PMID Year Title
26698646 2016 Actin-like 6A predicts poor prognosis of hepatocellular carcinoma and promotes metastasis and epithelial-mesenchymal transition.
26242195 2015 The Actin-Related Protein BAF53 Is Essential for Chromosomal Subdomain Integrity.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
23728344 2014 Failure to downregulate the BAF53a subunit of the SWI/SNF chromatin remodeling complex contributes to the differentiation block in rhabdomyosarcoma.
23395444 2013 ACTL6a enforces the epidermal progenitor state by suppressing SWI/SNF-dependent induction of KLF4.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22573825 2012 Heterocomplex formation by Arp4 and ?-actin is involved in the integrity of the Brg1 chromatin remodeling complex.
21821000 2011 Suppression of HPV E6 and E7 expression by BAF53 depletion in cervical cancer cells.
21699904 2011 Varying modulation of HIV-1 LTR activity by Baf complexes.
21303910 2011 Subunit organization of the human INO80 chromatin remodeling complex: an evolutionarily conserved core complex catalyzes ATP-dependent nucleosome remodeling.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18922472 2008 Distinct modes of regulation of the Uch37 deubiquitinating enzyme in the proteasome and in the Ino80 chromatin-remodeling complex.
18816825 2008 Baf60c is a component of the neural progenitor-specific BAF complex in developing retina.
18765789 2008 Regulation of muscle development by DPF3, a novel histone acetylation and methylation reader of the BAF chromatin remodeling complex.
18026119 2007 A YY1-INO80 complex regulates genomic stability through homologous recombination-based repair.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16230350 2005 A mammalian chromatin remodeling complex with similarities to the yeast INO80 complex.
16217013 2005 Heterogeneous nuclear ribonucleoprotein C1/C2, MeCP1, and SWI/SNF form a chromatin remodeling complex at the beta-globin locus control region.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15647280 2005 The mammalian YL1 protein is a shared subunit of the TRRAP/TIP60 histone acetyltransferase and SRCAP complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15196461 2004 The highly conserved and multifunctional NuA4 HAT complex.
14966270 2004 Structural and functional conservation of the NuA4 histone acetyltransferase complex from yeast to humans.
14743216 2004 A physical and functional map of the human TNF-alpha/NF-kappa B signal transduction pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14503849 2003 Cytoplasmic localization and nucleo-cytoplasmic shuttling of BAF53, a component of chromatin-modifying complexes.
12963728 2003 Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex.
12665591 2003 Novel SWI/SNF chromatin-remodeling complexes contain a mixed-lineage leukemia chromosomal translocation partner.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437990 2002 Brain-specific expression of the nuclear actin-related protein ArpNalpha and its involvement in mammalian SWI/SNF chromatin remodeling complex.
12353638 2002 Alternative splicing products of the gene for a human nuclear actin-related protein, hArpNbeta/Baf53, that encode a protein isoform, hArpNbetaS, in the cytoplasm.
11839798 2002 BAF53 forms distinct nuclear complexes and functions as a critical c-Myc-interacting nuclear cofactor for oncogenic transformation.
11734557 2002 SYT associates with human SNF/SWI complexes and the C-terminal region of its fusion partner SSX1 targets histones.
11726552 2001 Fanconi anemia protein, FANCA, associates with BRG1, a component of the human SWI/SNF complex.
11509179 2001 The p400 complex is an essential E1A transformation target.
11342225 2001 Identification of the human crooked neck gene by comparative gene identification.
11266125 2001 Identification of a nuclear protein ArpN as a component of human SWI/SNF complex and its selective association with a subset of active genes.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11078522 2000 The human SWI/SNF-B chromatin-remodeling complex is related to yeast rsc and localizes at kinetochores of mitotic chromosomes.
10966108 2000 Involvement of the TIP60 histone acetylase complex in DNA repair and apoptosis.
10611965 1999 Actin-related proteins.
10380635 1999 Two isoforms of a human actin-related protein show nuclear localization and mutually selective expression between brain and other tissues.
10078207 1999 Reconstitution of a core chromatin remodeling complex from SWI/SNF subunits.
9845365 1998 Rapid and phosphoinositol-dependent binding of the SWI/SNF-like BAF complex to chromatin after T lymphocyte receptor signaling.
9710619 1998 A human RNA polymerase II complex containing factors that modify chromatin structure.
8804307 1996 Diversity and specialization of mammalian SWI/SNF complexes.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.