Property Summary

NCBI Gene PubMed Count 33
PubMed Score 1025.27
PubTator Score 1106.45

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (4)

PMID Text
23675907 Data indicate that the positive expression of studied genes fertilization rate for GAPDHS positive subset was 66%, ACR - 71%, SPATA22 - 68%, MND1 - 70%, pregnancy rates were 8%, 6%, 18% and 36% respectively.
23297503 Sperm DNA damage is closely related with sperm-nucleoprotein transition, acrosin activity and seminal parameters.
22452365 DNA immunization against proacrosin impairs fertility in male mice.
15950651 Binding sites for recombinant human zona pellucida (ZP) glycoproteins located at the N- and C-termini of proacrosin reveal a key role of the proenzyme in the interaction.

AA Sequence

MVEMLPTAILLVLAVSVVAKDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSLQIFTYNSHRY      1 - 70
HTCGGSLLNSRWVLTAAHCFVGKNNVHDWRLVFGAKEITYGNNKPVKAPLQERYVEKIIIHEKYNSATEG     71 - 140
NDIALVEITPPISCGRFIGPGCLPHFKAGLPRGSQSCWVAGWGYIEEKAPRPSSILMEARVDLIDLDLCN    141 - 210
STQWYNGRVQPTNVCAGYPVGKIDTCQGDSGGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWP    211 - 280
YLNWIASKIGSNALRMIQSATPPPPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPPPSP    281 - 350
PPPPPPPASPLPPPPPPPPPTPSSTTKLPQGLSFAKRLQQLIEVLKGKTYSDGKNHYDMETTELPELTST    351 - 420
S//

Text Mined References (33)

PMID Year Title
23675907 2013 Expression analysis of MND1/GAJ, SPATA22, GAPDHS and ACR genes in testicular biopsies from non-obstructive azoospermia (NOA) patients.
23297503 2012 [Sperm DNA damage and sperm-nucleoprotein transition correlate to acrosin activity and seminal parameters].
22452365 2012 DNA immunization against proacrosin impairs fertility in male mice.
21630459 2011 Proteomic characterization of the human sperm nucleus.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15955892 The proacrosin binding protein, sp32, is tyrosine phosphorylated during capacitation of pig sperm.
15950652 2005 Binding of recombinant human proacrosin/acrosin to zona pellucida glycoproteins. II. Participation of mannose residues in the interaction.
15950651 2005 Binding of recombinant human proacrosin/acrosin to zona pellucida (ZP) glycoproteins. I. Studies with recombinant human ZPA, ZPB, and ZPC.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12931362 2003 [The effect of semen antisperm antibody on human sperm acrosin activity].
12801583 2003 Biochemical and molecular studies of the proacrosin/acrosin system in patients with unexplained infertility.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12398221 Role of acrosomal matrix proteases in sperm-zona pellucida interactions.
11839395 2002 Evaluation of the proacrosin/acrosin system and its mechanism of activation in human sperm extracts.
11739644 2001 Interactions between mouse ZP2 glycoprotein and proacrosin; a mechanism for secondary binding of sperm to the zona pellucida during fertilization.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10734459 1998 Determination of acrosin activity of boar spermatozoa by the clinical method: optimization of the assay and changes during short-term storage of semen.
10418103 1999 Functional interactions between sulphated polysaccharides and proacrosin: implications in sperm binding and digestion of zona pellucida.
10369396 1999 PH-20 but not acrosin is involved in sperm penetration of the macaque zona pellucida.
7521127 1994 Inhibition of acrosin by protein C inhibitor and localization of protein C inhibitor to spermatozoa.
6815104 1982 Inhibition of human and bovine sperm acrosin by divalent metal ions. Possible role of zinc as a regulator of acrosin activity.
6802470 1982 Purification of bovine and human acrosin.
6357995 1983 Acrosin and the acrosome in human spermatogenesis.
3880736 1985 Extraction of the adenylate cyclase-activating factor of bovine sperm and its identification as a trypsin-like protease.
2606479 1989 The gene encoding the human preproacrosin (ACR) maps to the q13-qter region on chromosome 22.
2550339 1989 Inhibition of the human sperm acrosome reaction by proteinase inhibitors.
2493394 1989 Primary structure of human proacrosin deduced from its cDNA sequence.
2298447 1990 Molecular cloning of human preproacrosin cDNA.
2114285 1990 Nucleotide sequence and exon-intron organization of the human proacrosin gene.
1937464 1991 Acrosin, the peculiar sperm-specific serine protease.
1907596 1991 Detection of human spermatid-specific transcripts in peripheral blood lymphocytes of males and females.
1783391 1991 Mouse proacrosin gene: nucleotide sequence, diploid expression, and chromosomal localization.
1628652 1992 Molecular cloning, sequencing and restriction mapping of the genomic sequence encoding human proacrosin.