Property Summary

Ligand Count 25
NCBI Gene PubMed Count 33
PubMed Score 1039.52
PubTator Score 1106.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (4)

AA Sequence

MVEMLPTAILLVLAVSVVAKDNATCDGPCGLRFRQNPQGGVRIVGGKAAQHGAWPWMVSLQIFTYNSHRY      1 - 70
HTCGGSLLNSRWVLTAAHCFVGKNNVHDWRLVFGAKEITYGNNKPVKAPLQERYVEKIIIHEKYNSATEG     71 - 140
NDIALVEITPPISCGRFIGPGCLPHFKAGLPRGSQSCWVAGWGYIEEKAPRPSSILMEARVDLIDLDLCN    141 - 210
STQWYNGRVQPTNVCAGYPVGKIDTCQGDSGGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWP    211 - 280
YLNWIASKIGSNALRMIQSATPPPPTTRPPPIRPPFSHPISAHLPWYFQPPPRPLPPRPPAAQPRPPPSP    281 - 350
PPPPPPPASPLPPPPPPPPPTPSSTTKLPQGLSFAKRLQQLIEVLKGKTYSDGKNHYDMETTELPELTST    351 - 420
S//

Text Mined References (33)

PMID Year Title