Property Summary

NCBI Gene PubMed Count 2
PubMed Score 34.52
PubTator Score 4.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6685 4.0e-19
gastric carcinoma 832 1.3e-02
non primary Sjogren syndrome sicca 840 2.2e-02

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.400 2.2e-02
gastric carcinoma -1.800 1.3e-02
psoriasis -1.900 4.0e-19

AA Sequence

MAGLGFWGHPAGPLLLLLLLVLPPRALPEGPLVFVALVFRHGDRAPLASYPMDPHKEVASTLWPRGLGQL      1 - 70
TTEGVRQQLELGRFLRSRYEAFLSPEYRREEVYIRSTDFDRTLESAQANLAGLFPEAAPGSPEARWRPIP     71 - 140
VHTVPVAEDKLLRFPMRSCPRYHELLREATEAAEYQEALEGWTGFLSRLENFTGLSLVGEPLRRAWKVLD    141 - 210
TLMCQQAHGLPLPAWASPDVLRTLAQISALDIGAHVGPPRAAEKAQLTGGILLNAILANFSRVQRLGLPL    211 - 280
KMVMYSAHDSTLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRNDSAHLPLPLSL    281 - 350
PGCPAPCPLGRFYQLTAPARPPAHGVSCHGPYEAAIPPAPVVPLLAGAVAVLVALSLGLGLLAWRPGCLR    351 - 420
ALGGPV                                                                    421 - 426
//

Text Mined References (2)

PMID Year Title
15219672 2004 Regulation of ErbB4 phosphorylation and cleavage by a novel histidine acid phosphatase.
11414767 2001 Molecular cloning of a novel human acid phosphatase gene (ACPT) that is highly expressed in the testis.