Property Summary

NCBI Gene PubMed Count 50
PubMed Score 166.49
PubTator Score 86.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
malignant mesothelioma -2.400 2.2e-06
psoriasis -2.000 3.6e-07
osteosarcoma -4.789 5.1e-06
group 4 medulloblastoma -1.700 1.9e-04
medulloblastoma, large-cell -2.000 1.3e-04
pancreatic ductal adenocarcinoma liver m... -1.775 1.6e-02
non-small cell lung cancer -2.152 2.9e-27
colon cancer -2.000 2.5e-05
lung cancer -4.900 2.0e-05
pancreatic cancer -1.300 1.3e-03
Breast cancer -2.900 2.4e-02
pediatric high grade glioma -1.100 2.3e-03
pilocytic astrocytoma -1.200 8.2e-04
primary Sjogren syndrome -1.500 2.2e-02
lung adenocarcinoma -1.550 2.0e-08
breast carcinoma -2.100 8.9e-23
ductal carcinoma in situ -3.900 1.2e-04
invasive ductal carcinoma -5.000 2.6e-04
ovarian cancer -2.500 2.6e-06
dermatomyositis 1.100 7.0e-03

Protein-protein Interaction (2)

Gene RIF (45)

PMID Text
26362536 HIV-1 Gag interacts with ACACB as demonstrated by proximity dependent biotinylation proteomics
26030797 A significant association exists of ACACB gene polymorphism and diabetic nephropathy among Caucasian patients with diabetes.
26022126 The knockdown of ACC2 reduced palmitic acid -induced autophagy and thus protects the cells from palmitic acid - induced lipotoxicity with attenuated lipid accumulation and rescued cell viability.
25262148 Our meta-analysis supports that the apolipoprotein E epsilon2 allele and acetyl-CoA carboxylase beta rs2268388 C>T might act as promotion factors of nephropathy in type 2 diabetes.
23460794 These data support a role for ACACB in obesity and potential roles for altered lipid metabolism in susceptibility to diabetic nephropathy.
23156397 Its involvement in the development of diabetic nephropathy is explained by the promotion of the so-called micro-inflammation associated with the diabetic state.
23081748 TT genotypes of ACACB gene (rs2268388) and CC genotype of AGTR1 gene (rs5186) confers the risk of diabetic nephropathy in Asian Indian patients with T2DM.
21953464 Structure-guided inhibitor design for human acetyl-coenzyme A carboxylase by interspecies active site conversion.
21908218 In conclusion, common polymorphisms of ACACB gene are associated with obesity and, independently, with type 2 diabetes in postmenopausal women
21887335 Common variants within the ACACB locus appear to regulate adipose gene expression
21553357 A gene polymorphism in acetyl-coenzyme A carboxylase beta may be associated with the C-reactive protein level in a prediabetic and diabetic population.
21344388 HIV-1 Gag interacts with ACACB as demonstrated by proximity dependent biotinylation proteomics
20965718 Observational study of gene-disease association. (HuGE Navigator)
20877624 Observational study of gene-disease association. (HuGE Navigator)
20855566 Acetyl-CoA carboxylase beta (ACC2) plays a key role in fatty acid synthesis and oxidation pathways.
20855566 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20799892 The -368 C/T single-nucleotide polymorphism in ACACB P-II binds HepG2 nuclear proteins that affect promoter activity in an allele-specific fashion.
20602615 Observational study of gene-disease association. (HuGE Navigator)
20599696 This study demonstrates that NRF-1 is a novel transcriptional inhibitor of the human ACCbeta gene promoter in the mammalian heart.
20519229 The acetyl-coenzyme A carboxylase beta (ACACB) gene is associated with nephropathy in Chinese patients with type 2 diabetes.
20519229 Observational study of gene-disease association. (HuGE Navigator)
20514549 ACACB overexpression in renal proximal tubular epithelial cell increased proinflammatory cytokine expression, such as IL-6, at least partly by increasing mRNA stability through a p38 MAPK-dependent pathway.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20168990 These results suggest that ACACB is a strong candidate for conferring susceptibility for proteinuria in patients with type 2 diabetes.
20168990 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20139635 data suggest that insulin and glucocorticoid have positive effects on both acetyl-CoA carboxylase alpha(ACC1) and beta(ACC2) gene transcription
19900410 the crystal structures of the biotin carboxylase domain of human ACC2 phosphorylated by AMP-activated protein kinase was reported.
19846279 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19720090 HIV-1 Gag interacts with ACACB as demonstrated by proximity dependent biotinylation proteomics
19618481 results point towards major differences in ACC tissue distribution between humans and rats
19390150 The human ACC2 CT-domain C-terminus is comprised of three intertwined alpha-helices that extend outwards from the enzyme on the opposite side to the ligand-binding site.
19190759 Human adipose tissue, unlike rodent adipose, expresses more ACC2 mRNA relative to the oxidative tissues muscle and heart.
19034549 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18976975 HIV-1 Gag interacts with ACACB as demonstrated by proximity dependent biotinylation proteomics
18976975 Knockdown of acetyl-CoA carboxylase beta (ACACB) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18455495 Differential activation of recombinant ACC1 and ACC2 by citrate is reported.
18031993 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17521700 observations provide complete information about the pattern and levels of LKB1 and p-ACC immunostaining in normal tissues and in lung tumors
17223360 The expression, purification, and characterization of ACC2 were investigated.
15590647 differential regulation of ACCbeta gene expression between tissues
14627750 down-regulation of acetyl coa carboxylase 2 (ACC2) mRNA, induced by the lowering of plasma insulin concentration, is related to improvement of insulin sensitivity
12413941 elevation of AMPK via phosphorylation is not sufficient to maintain elevated ACCbeta Ser(221) phosphorylation during exercise
12086953 The effect of a 3-month low-intensity endurance training program on fat oxidation and expression

AA Sequence

MVLLLCLSCLIFSCLTFSWLKIWGKMTDSKPITKSKSEANLIPSQEPFPASDNSGETPQRNGEGHTLPKT      1 - 70
PSQAEPASHKGPKDAGRRRNSLPPSHQKPPRNPLSSSDAAPSPELQANGTGTQGLEATDTNGLSSSARPQ     71 - 140
GQQAGSPSKEDKKQANIKRQLMTNFILGSFDDYSSDEDSVAGSSRESTRKGSRASLGALSLEAYLTTGEA    141 - 210
ETRVPTMRPSMSGLHLVKRGREHKKLDLHRDFTVASPAEFVTRFGGDRVIEKVLIANNGIAAVKCMRSIR    211 - 280
RWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGPNNNNYANVELIVDIAKRIPVQAVWAG    281 - 350
WGHASENPKLPELLCKNGVAFLGPPSEAMWALGDKIASTVVAQTLQVPTLPWSGSGLTVEWTEDDLQQGK    351 - 420
RISVPEDVYDKGCVKDVDEGLEAAERIGFPLMIKASEGGGGKGIRKAESAEDFPILFRQVQSEIPGSPIF    421 - 490
LMKLAQHARHLEVQILADQYGNAVSLFGRDCSIQRRHQKIVEEAPATIAPLAIFEFMEQCAIRLAKTVGY    491 - 560
VSAGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMIADVNLPAAQLQIAMGVPLHRLKDIRLLYGESPWGV    561 - 630
TPISFETPSNPPLARGHVIAARITSENPDEGFKPSSGTVQELNFRSSKNVWGYFSVAATGGLHEFADSQF    631 - 700
GHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLINLLETESFQNNDIDTGWLDYLIAEKVQAEKPD    701 - 770
IMLGVVCGALNVADAMFRTCMTDFLHSLERGQVLPADSLLNLVDVELIYGGVKYILKVARQSLTMFVLIM    771 - 840
NGCHIEIDAHRLNDGGLLLSYNGNSYTTYMKEEVDSYRITIGNKTCVFEKENDPTVLRSPSAGKLTQYTV    841 - 910
EDGGHVEAGSSYAEMEVMKMIMTLNVQERGRVKYIKRPGAVLEAGCVVARLELDDPSKVHPAEPFTGELP    911 - 980
AQQTLPILGEKLHQVFHSVLENLTNVMSGFCLPEPVFSIKLKEWVQKLMMTLRHPSLPLLELQEIMTSVA    981 - 1050
GRIPAPVEKSVRRVMAQYASNITSVLCQFPSQQIATILDCHAATLQRKADREVFFINTQSIVQLVQRYRS   1051 - 1120
GIRGYMKTVVLDLLRRYLRVEHHFQQAHYDKCVINLREQFKPDMSQVLDCIFSHAQVAKKNQLVIMLIDE   1121 - 1190
LCGPDPSLSDELISILNELTQLSKSEHCKVALRARQILIASHLPSYELRHNQVESIFLSAIDMYGHQFCP   1191 - 1260
ENLKKLILSETTIFDVLPTFFYHANKVVCMASLEVYVRRGYIAYELNSLQHRQLPDGTCVVEFQFMLPSS   1261 - 1330
HPNRMTVPISITNPDLLRHSTELFMDSGFSPLCQRMGAMVAFRRFEDFTRNFDEVISCFANVPKDTPLFS   1331 - 1400
EARTSLYSEDDCKSLREEPIHILNVSIQCADHLEDEALVPILRTFVQSKKNILVDYGLRRITFLIAQEKE   1401 - 1470
FPKFFTFRARDEFAEDRIYRHLEPALAFQLELNRMRNFDLTAVPCANHKMHLYLGAAKVKEGVEVTDHRF   1471 - 1540
FIRAIIRHSDLITKEASFEYLQNEGERLLLEAMDELEVAFNNTSVRTDCNHIFLNFVPTVIMDPFKIEES   1541 - 1610
VRYMVMRYGSRLWKLRVLQAEVKINIRQTTTGSAVPIRLFITNESGYYLDISLYKEVTDSRSGNIMFHSF   1611 - 1680
GNKQGPQHGMLINTPYVTKDLLQAKRFQAQTLGTTYIYDFPEMFRQALFKLWGSPDKYPKDILTYTELVL   1681 - 1750
DSQGQLVEMNRLPGGNEVGMVAFKMRFKTQEYPEGRDVIVIGNDITFRIGSFGPGEDLLYLRASEMARAE   1751 - 1820
GIPKIYVAANSGARIGMAEEIKHMFHVAWVDPEDPHKGFKYLYLTPQDYTRISSLNSVHCKHIEEGGESR   1821 - 1890
YMITDIIGKDDGLGVENLRGSGMIAGESSLAYEEIVTISLVTCRAIGIGAYLVRLGQRVIQVENSHIILT   1891 - 1960
GASALNKVLGREVYTSNNQLGGVQIMHYNGVSHITVPDDFEGVYTILEWLSYMPKDNHSPVPIITPTDPI   1961 - 2030
DREIEFLPSRAPYDPRWMLAGRPHPTLKGTWQSGFFDHGSFKEIMAPWAQTVVTGRARLGGIPVGVIAVE   2031 - 2100
TRTVEVAVPADPANLDSEAKIIQQAGQVWFPDSAYKTAQAVKDFNREKLPLMIFANWRGFSGGMKDMYDQ   2101 - 2170
VLKFGAYIVDGLRQYKQPILIYIPPYAELRGGSWVVIDATINPLCIEMYADKESRGGVLEPEGTVEIKFR   2171 - 2240
KKDLIKSMRRIDPAYKKLMEQLGEPDLSDKDRKDLEGRLKAREDLLLPIYHQVAVQFADFHDTPGRMLEK   2241 - 2310
GVISDILEWKTARTFLYWRLRRLLLEDQVKQEILQASGELSHVHIQSMLRRWFVETEGAVKAYLWDNNQV   2311 - 2380
VVQWLEQHWQAGDGPRSTIRENITYLKHDSVLKTIRGLVEENPEVAVDCVIYLSQHISPAERAQVVHLLS   2381 - 2450
TMDSPAST                                                                 2451 - 2458
//

Text Mined References (56)

PMID Year Title
26030797 2015 The ACACB gene rs2268388 polymorphism is associated with nephropathy in Caucasian patients with diabetes: a meta-analysis.
26022126 2015 Acetyl-CoA carboxylase 2 suppression rescues human proximal tubular cells from palmitic acid induced lipotoxicity via autophagy.
25262148 2015 The association between lipid metabolism gene polymorphisms and nephropathy in type 2 diabetes: a meta-analysis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23460794 2013 An ACACB variant implicated in diabetic nephropathy associates with body mass index and gene expression in obese subjects.
23156397 2012 [Genetic study for diabetic microvascular complications--recent advances and future perspectives].
23081748 2013 ACAC? gene (rs2268388) and AGTR1 gene (rs5186) polymorphism and the risk of nephropathy in Asian Indian patients with type 2 diabetes.
21953464 2011 Structure-guided inhibitor design for human acetyl-coenzyme A carboxylase by interspecies active site conversion.
21908218 2011 Association of ACACB polymorphisms with obesity and diabetes.
21887335 2011 The effect of ACACB cis-variants on gene expression and metabolic traits.
21553357 2012 A gene polymorphism in acetyl-coenzyme A carboxylase beta may be associated with the C-reactive protein level in a prediabetic and diabetic population.
20965718 2011 Genetic variability of the fatty acid synthase pathway is not associated with prostate cancer risk in the European Prospective Investigation on Cancer (EPIC).
20952656 2010 Crystal structure of Spot 14, a modulator of fatty acid synthesis.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20855566 2010 ACC2 gene polymorphisms, metabolic syndrome, and gene-nutrient interactions with dietary fat.
20799892 2010 Functional single-nucleotide polymorphism in acetyl-CoA carboxylase ACACB gene promoter.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20599696 2010 AMPK activation represses the human gene promoter of the cardiac isoform of acetyl-CoA carboxylase: Role of nuclear respiratory factor-1.
20519229 2010 The acetyl-coenzyme A carboxylase beta (ACACB) gene is associated with nephropathy in Chinese patients with type 2 diabetes.
20514549 2010 Overexpression of acetyl-coenzyme A carboxylase beta increases proinflammatory cytokines in cultured human renal proximal tubular epithelial cells.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20168990 2010 A single nucleotide polymorphism within the acetyl-coenzyme A carboxylase beta gene is associated with proteinuria in patients with type 2 diabetes.
20139635 2010 Hormonal regulation of acetyl-CoA carboxylase isoenzyme gene transcription.
20085763 2010 The N-terminal domain of human holocarboxylase synthetase facilitates biotinylation via direct interaction with the substrate protein.
19900410 2010 Molecular mechanism for the regulation of human ACC2 through phosphorylation by AMPK.
19846279 2009 Acetyl-coenzyme A carboxylase alpha gene variations may be associated with the direct effects of some antipsychotics on triglyceride levels.
19618481 2009 Acetyl-CoA carboxylases 1 and 2 show distinct expression patterns in rats and humans and alterations in obesity and diabetes.
19390150 2009 The human ACC2 CT-domain C-terminus is required for full functionality and has a novel twist.
19190759 2009 ACC2 is expressed at high levels in human white adipose and has an isoform with a novel N-terminus [corrected].
19034549 2008 Prediction of the metabolic syndrome status based on dietary and genetic parameters, using Random Forest.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18772397 2008 Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18455495 2008 Differential activation of recombinant human acetyl-CoA carboxylases 1 and 2 by citrate.
18031993 2008 Exploring genetic variations that may be associated with the direct effects of some antipsychotics on lipid levels.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17876819 2008 Crystal structure of the biotin carboxylase domain of human acetyl-CoA carboxylase 2.
17521700 2007 Specific pattern of LKB1 and phospho-acetyl-CoA carboxylase protein immunostaining in human normal tissues and lung carcinomas.
17223360 2007 Expression, purification, and characterization of human acetyl-CoA carboxylase 2.
16854592 2007 Expression, purification, and characterization of human and rat acetyl coenzyme A carboxylase (ACC) isozymes.
16794074 2006 TRB3 links the E3 ubiquitin ligase COP1 to lipid metabolism.
16541075 2006 The finished DNA sequence of human chromosome 12.
16054041 2005 AMP-activated protein kinase: ancient energy gauge provides clues to modern understanding of metabolism.
15590647 2005 Alternative usages of multiple promoters of the acetyl-CoA carboxylase beta gene are related to differential transcriptional regulation in human and rodent tissues.
15060529 2004 AMP kinase and malonyl-CoA: targets for therapy of the metabolic syndrome.
14627750 2003 Decreased muscle acetyl-coenzyme A carboxylase 2 mRNA and insulin resistance in formerly obese subjects.
12488245 2003 Regulation of 5'AMP-activated protein kinase activity and substrate utilization in exercising human skeletal muscle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12413941 2002 Dissociation of AMPK activity and ACCbeta phosphorylation in human muscle during prolonged exercise.
11257506 2001 Molecular enzymology of carnitine transfer and transport.
10677481 2000 The subcellular localization of acetyl-CoA carboxylase 2.
9284908 1997 Assignment of acetyl-CoA carboxylase-beta (ACACB) to human chromosome band 12q24.1 by in situ hybridization.
9099716 1997 Human acetyl-CoA carboxylase 2. Molecular cloning, characterization, chromosomal mapping, and evidence for two isoforms.
8876158 1996 Cloning of human acetyl-CoA carboxylase-beta and its unique features.
8670171 1996 Identification of a second human acetyl-CoA carboxylase gene.