Property Summary

NCBI Gene PubMed Count 20
PubMed Score 194.96
PubTator Score 45.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
chronic lymphocytic leukemia 1.423 1.0e-02
osteosarcoma -2.375 3.3e-08
glioblastoma -1.500 1.1e-03
group 4 medulloblastoma -2.600 1.2e-06
atypical teratoid / rhabdoid tumor -1.500 2.0e-05
medulloblastoma, large-cell -2.800 3.2e-05
primitive neuroectodermal tumor -1.200 3.2e-03
intraductal papillary-mucinous carcinoma... 1.200 4.4e-02
adult high grade glioma -1.300 1.5e-03
ovarian cancer -1.700 4.1e-07

Gene RIF (3)

PMID Text
24162774 HIV-1 gp120 upregulates the expression of active BCR-related (ABR) in human B cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
11921339 During vestibular morphogenesis, Abr and Bcr play complementary roles. Small Rho-related GTPases like Abr and Bcr are important for balance and motor coordination.

AA Sequence

MEPLSHRGLPRLSWIDTLYSNFSYGTDEYDGEGNEEQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDG      1 - 70
VSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATATTSQPVLTIQQIETIF     71 - 140
YKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNYKVALETAEKCSQSNNQFQK    141 - 210
ISEELKVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSS    211 - 280
INEDIDPRRTAVTTPKGETRQLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYI    281 - 350
PLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLL    351 - 420
NSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTVHNIPV    421 - 490
TSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKTRVFRDTAEPKWDEEFEIELE    491 - 560
GSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRD    561 - 630
MSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDA    631 - 700
NNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRSLPDPNLI    701 - 770
TFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQH    771 - 840
PPISFAELKRNTLYFSTDV                                                       841 - 859
//

Text Mined References (21)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15525470 2004 Yeast two-hybrid screening for proteins that interact with alpha1-adrenergic receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12621583 2003 Refinement of a 400-kb critical region allows genotypic differentiation between isolated lissencephaly, Miller-Dieker syndrome, and other phenotypes secondary to deletions of 17p13.3.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
11921339 2002 Vestibular dysgenesis in mice lacking Abr and Bcr Cdc42/RacGAPs.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8349582 1993 Human ABR encodes a protein with GAPrac activity and homology to the DBL nucleotide exchange factor domain.
8262969 1993 The human active breakpoint cluster region-related gene encodes a brain protein with homology to guanine nucleotide exchange proteins and GTPase-activating proteins.
7829075 1994 Physical mapping of chromosome 17p13.3 in the region of a putative tumor suppressor gene important in medulloblastoma.
7479768 1995 Abr and Bcr are multifunctional regulators of the Rho GTP-binding protein family.
2587217 1989 ABR, an active BCR-related gene.