Property Summary

NCBI Gene PubMed Count 28
PubMed Score 21.43
PubTator Score 18.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute myeloid leukemia -1.400 3.7e-02
atypical teratoid / rhabdoid tumor 1.500 9.4e-09
Breast cancer -1.100 1.7e-12
chronic rhinosinusitis -1.047 1.3e-03
ependymoma -1.100 3.3e-02
glioblastoma 1.300 2.7e-04
Hydrolethalus syndrome 1.486 3.9e-02
intraductal papillary-mucinous adenoma (... 1.400 4.8e-02
intraductal papillary-mucinous neoplasm ... 2.000 4.6e-02
juvenile dermatomyositis 1.010 6.5e-11
lung cancer 1.400 2.8e-04
malignant mesothelioma -1.100 2.7e-06
medulloblastoma, large-cell 1.500 1.1e-05
osteosarcoma 1.501 8.1e-06
ovarian cancer -2.200 3.3e-08
pediatric high grade glioma 1.200 2.8e-03
psoriasis 1.300 1.3e-04
spina bifida 1.122 2.3e-02
tuberculosis -1.300 3.1e-05

Gene RIF (7)

AA Sequence

MAELQMLLEEEIPGGRRALFDSYTNLERVADYCENNYIQSADKQRALEETKAYTTQSLASVAYLINTLAN      1 - 70
NVLQMLDIQASQLRRMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKP     71 - 140
IDYTILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPVVP    141 - 210
NDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSVGVPIAVPTPSPPS    211 - 280
VFPAPAGSAGTPPLPATSASAPAPLVPATVPSSTAPNAAAGGAPNLADGFTSPTPPVVSSTPPTGHPVQF    281 - 350
YSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQMNGGPFYSQNPVSDTPPPPPPVEEPVFDESPPPP    351 - 420
PPPEDYEEEEAAVVEYSDPYAEEDPPWAPRSYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYE    421 - 490
GVMNGVTGLFPGNYVESIMHYSE                                                   491 - 513
//

Text Mined References (34)

PMID Year Title