Property Summary

NCBI Gene PubMed Count 22
PubMed Score 7.01
PubTator Score 12.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (7)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19151771 mutations in ABCB8 and ABCB10 is not associated with acute myeloid leukemia.
19147539 ABCB8 confers resistance through the protection of mitochondrial DNA from doxorubicin-induced DNA damage in a melanoma cell line.

AA Sequence

MLVHLFRVGIRGGPFPGRLLPPLRFQTFSAVRNTWRNGKTGQLHKAEGEYSDGYRSSSLLRAVAHLRSQL      1 - 70
WAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPPASSTPHVVGSRFNWKLFWQF     71 - 140
LHPHLLVLGVAVVLALGAALVNVQIPLLLGQLVEVVAKYTRDHVGSFMTESQNLSTHLLILYGVQGLLTF    141 - 210
GYLVLLSHVGERMAVDMRRALFSSLLRQDITFFDANKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQV    211 - 280
AGCLVSLSMLSTRLTLLLMVATPALMGVGTLMGSGLRKLSRQCQEQIARAMGVADEALGNVRTVRAFAME    281 - 350
QREEERYGAELEACRCRAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLTGGDLMSFLVASQT    351 - 420
VQRSMANLSVLFGQVVRGLSAGARVFEYMALNPCIPLSGGCCVPKEQLRGSVTFQNVCFSYPCRPGFEVL    421 - 490
KDFTLTLPPGKIVALVGQSGGGKTTVASLLERFYDPTAGVVMLDGRDLRTLDPSWLRGQVVGFISQEPVL    491 - 560
FGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEGYNTVVGERGTTLSGGQKQRLAIARALIKQP    561 - 630
TVLILDEATSALDAESERVVQEALDRASAGRTVLVIAHRLSTVRGAHCIVVMADGRVWEAGTHEELLKKG    631 - 700
GLYAELIRRQALDAPRTAAPPPKKPEGPRSHQHKS                                       701 - 735
//

Text Mined References (26)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23512405 2013 Profiling of ABC transporters during active ulcerative colitis and in vitro effect of inflammatory modulators.
22375032 2012 Disruption of ATP-binding cassette B8 in mice leads to cardiomyopathy through a decrease in mitochondrial iron export.
21046154 2011 Mithramycin A suppresses expression of the human melanoma-associated gene ABCB8.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19248758 2009 Mitochondrial ABC proteins in health and disease.
19151771 2009 Exclusion of ABCB8 and ABCB10 as cancer candidate genes in acute myeloid leukemia.
19147539 2009 ABCB8 mediates doxorubicin resistance in melanoma cells by protecting the mitochondrial genome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16259955 2005 Targeting of the mitochondrial membrane proteins to the cell surface for functional studies.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15284438 2004 Multiprotein complex containing succinate dehydrogenase confers mitochondrial ATP-sensitive K+ channel activity.
14973057 2004 Alteration in copy numbers of genes as a mechanism for acquired drug resistance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11829140 2002 Three hundred twenty-six genetic variations in genes encoding nine members of ATP-binding cassette, subfamily B (ABCB/MDR/TAP), in the Japanese population.
9878413 1999 Identification and characterization of a mammalian mitochondrial ATP-binding cassette membrane protein.
8894702 1996 Characterization of the human ABC superfamily: isolation and mapping of 21 new genes using the expressed sequence tags database.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.