Property Summary

NCBI Gene PubMed Count 41
PubMed Score 124.15
PubTator Score 51.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.042 6.5e-05
medulloblastoma, large-cell 1.100 1.4e-05
non primary Sjogren syndrome sicca -1.100 1.6e-02
ductal carcinoma in situ -1.400 1.3e-02
invasive ductal carcinoma -1.900 7.0e-03
ovarian cancer 1.200 2.7e-10

Gene RIF (32)

PMID Text
26827764 ABCB5 has a role in chemoresistance in Merkel Cell Carcinoma
26666373 Results suggest that ATP binding cassette subfamily B member 5 ABCB5/Abcb5 upregulates cellular glutathione levels to protect cells from various poisons.
26554847 This is the first study showing the relationship between miR-340-5p and expression of ABCB5 in melanoma cells
26321644 ATP-binding cassette member B5 (ABCB5) identifies dermal immunoregulatory cells capable of exerting therapeutic immunoregulatory functions through engagement of programmed cell death 1.
25689483 c-MYC confers resistance to 5-fluorouracil through regulating ABCB5 expression in human colon cancer cells.
25647612 ABCB5 alleles alter susceptibility to haloperidol-induced toxicity (HIT) in mouse and humans.
25449786 The resistance of CD133(+) melanoma subpopulation is attributed to the enhanced drug efflux mediated by ATP-binding cassette sub-family B member 5 (ABCB5), since the knockdown of ABCB5 was found to sensitize CD133(+) cells to CAPE.
25030174 ATP-binding cassette, sub-family B, member 5 (ABCB5) marks limbal stem cells (LSCs) and is required for LSC maintenance, corneal development and repair
24934811 In melanoma-initiating cells, ABCB5 controls IL1beta secretion, which serves to maintain slow cycling, chemoresistant cells through an IL1beta/IL8/CXCR1 cytokine signaling circuit.
24804815 ABCB5 and MDR1 gene expression correlate with drug resistance in acute leukemia patients.
24525737 Suggest that the helicase HAGE has a key role in the resistance of ABCB5+ malignant melanoma stem cells to IFNalpha treatment by promoting SOCS1 expression.
24300535 Our results show that ABCB5 is preferentially expressed in the cytotrophoblast layer of placental villi.
23770371 Novel associations of the ABCB5 K115E polymorphism with human pigmentation phenotype and melanoma risk are observed.
23770371 Genetically determined ABCB5 functionality correlates with pigmentation phenotype and melanoma risk. Three ABCB5 SNPs, i.e. rs10231520, rs17817117 and rs2301641 (encoding the non-synonymous amino acid change K115E), were associated with decreased clinical melanoma risk. Additionally, the rs2301641 SNP was associated with non-red compared to red human hair color.
22865455 Data show that CD133(+) and ABCB5(+) subpopulations are colocalized in melanomas in perivascular niches that contain CD144 (VE-cadherin)(+) melanoma cells forming vessel-like channels, a phenomenon termed vasculogenic mimicry (VM).
22784549 High ABCB5 expression was significantly associated with tumour progression and recurrence of the tumour.
22555176 The gradual increase in the expression of ABCB5 from benign nevus to in situ to invasive melanoma suggests that it plays a role in melanomagenesis.
22393060 the helicase HAGE is required for ABCB5+ MMIC-dependent tumor growth through promoting RAS protein expression
22044138 ABCB5 may be responsible for both the progression and chemotherapeutic refractoriness of advanced acute leukemia.
21652540 ABCB5 mediates 5-FU resistance in cultured human colorectal cancer cells and affected tumor growth in xenografts.
21298007 ABCB5 beta may have evolved to play a specific role in human pigment cells and/or melanoma cells where it is predominantly expressed.
21212411 Results demonstrate that VEGFR-1 expressed by ABCB5+ malignant melanoma initiating cells functions to induce tumor vasculogenic mimicry and associated production of the pro-proliferative melanoma mitogen laminin, thereby promoting tumor growth.
20950786 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20729912 Tenascin-C promotes melanoma progression by maintaining the ABCB5-positive side population.
20682318 Expression of GEP and ABCB5 in liver cancer stem cells is associated with chemoresistance and reduced survival times of patients with hepatocellular carcinoma.
20068175 Results identify novel T-cell modulatory functions of ABCB5(+) melanoma subpopulations and suggest specific roles for these malignant melanoma initiating cells in the evasion of antitumor immunity and in cancer immunotherapeutic resistance.
18202660 ABCB5 expression identifies melanoma stem cells and correlates with clinical disease progression in melanoma patients. In vivo targeting of ABCB5+ melanoma stem cells inhibits tumor growth in human to mouse melanoma xenotransplantation models.
17661346 6-mercaptopurine decreased iNOS expression and increased MRP5 mRNA levels.
15899824 ABCB5 mediates chemoresistance in stem cell phenotype-expressing human malignant melanoma cells.
15760339 expression of ABCB 5alpha/beta might possibly provide two novel molecular markers for differential diagnosis of melanomas and constitute potential molecular targets for therapy of melanomas
12960149 ABCB5 P-glycoprotein functions include: Regulation of progenitor cell fusion; Regulation of cell membrane potential; Rhodamine-123 transport.
9542318 Treatment of CD4+ and CD8+ T cells with HIV-1 gp120 increases the intracellular expression of P-glycoprotein (P-gp)

AA Sequence

MENSERAEEMQENYQRNGTAEEQPKLRKEAVGSIEIFRFADGLDITLMILGILASLVNGACLPLMPLVLG      1 - 70
EMSDNLISGCLVQTNTTNYQNCTQSQEKLNEDMTLLTLYYVGIGVAALIFGYIQISLWIITAARQTKRIR     71 - 140
KQFFHSVLAQDIGWFDSCDIGELNTRMTDDIDKISDGIGDKIALLFQNMSTFSIGLAVGLVKGWKLTLVT    141 - 210
LSTSPLIMASAAACSRMVISLTSKELSAYSKAGAVAEEVLSSIRTVIAFRAQEKELQRYTQNLKDAKDFG    211 - 280
IKRTIASKVSLGAVYFFMNGTYGLAFWYGTSLILNGEPGYTIGTVLAVFFSVIHSSYCIGAAVPHFETFA    281 - 350
IARGAAFHIFQVIDKKPSIDNFSTAGYKPESIEGTVEFKNVSFNYPSRPSIKILKGLNLRIKSGETVALV    351 - 420
GLNGSGKSTVVQLLQRLYDPDDGFIMVDENDIRALNVRHYRDHIGVVSQEPVLFGTTISNNIKYGRDDVT    421 - 490
DEEMERAAREANAYDFIMEFPNKFNTLVGEKGAQMSGGQKQRIAIARALVRNPKILILDEATSALDSESK    491 - 560
SAVQAALEKASKGRTTIVVAHRLSTIRSADLIVTLKDGMLAEKGAHAELMAKRGLYYSLVMSQDIKKADE    561 - 630
QMESMTYSTERKTNSLPLHSVKSIKSDFIDKAEESTQSKEISLPEVSLLKILKLNKPEWPFVVLGTLASV    631 - 700
LNGTVHPVFSIIFAKIITMFGNNDKTTLKHDAEIYSMIFVILGVICFVSYFMQGLFYGRAGEILTMRLRH    701 - 770
LAFKAMLYQDIAWFDEKENSTGGLTTILAIDIAQIQGATGSRIGVLTQNATNMGLSVIISFIYGWEMTFL    771 - 840
ILSIAPVLAVTGMIETAAMTGFANKDKQELKHAGKIATEALENIRTIVSLTREKAFEQMYEEMLQTQHRN    841 - 910
TSKKAQIIGSCYAFSHAFIYFAYAAGFRFGAYLIQAGRMTPEGMFIVFTAIAYGAMAIGETLVLAPEYSK    911 - 980
AKSGAAHLFALLEKKPNIDSRSQEGKKPDTCEGNLEFREVSFFYPCRPDVFILRGLSLSIERGKTVAFVG    981 - 1050
SSGCGKSTSVQLLQRLYDPVQGQVLFDGVDAKELNVQWLRSQIAIVPQEPVLFNCSIAENIAYGDNSRVV   1051 - 1120
PLDEIKEAANAANIHSFIEGLPEKYNTQVGLKGAQLSGGQKQRLAIARALLQKPKILLLDEATSALDNDS   1121 - 1190
EKVVQHALDKARTGRTCLVVTHRLSAIQNADLIVVLHNGKIKEQGTHQELLRNRDIYFKLVNAQSVQ      1191 - 1257
//

Text Mined References (45)

PMID Year Title
26827764 2016 ABCB5-Targeted Chemoresistance Reversal Inhibits Merkel Cell Carcinoma Growth.
26666373 2015 Upregulation of cellular glutathione levels in human ABCB5- and murine Abcb5-transfected cells.
26554847 2015 Diminution of miR-340-5p levels is responsible for increased expression of ABCB5 in melanoma cells under oxygen-deprived conditions.
26321644 2015 ABCB5 Identifies Immunoregulatory Dermal Cells.
25689483 2015 The c-MYC-ABCB5 axis plays a pivotal role in 5-fluorouracil resistance in human colon cancer cells.
25647612 2015 The role of Abcb5 alleles in susceptibility to haloperidol-induced toxicity in mice and humans.
25449786 2015 CD133? melanoma subpopulation acquired resistance to caffeic acid phenethyl ester-induced apoptosis is attributed to the elevated expression of ABCB5: significance for melanoma treatment.
25030174 2014 ABCB5 is a limbal stem cell gene required for corneal development and repair.
24934811 2014 ABCB5 maintains melanoma-initiating cells through a proinflammatory cytokine signaling circuit.
24804815 2014 The clinical relevance and prognostic significance of adenosine triphosphate ATP-binding cassette (ABCB5) and multidrug resistance (MDR1) genes expression in acute leukemia: an Egyptian study.
24525737 2014 The helicase HAGE prevents interferon-?-induced PML expression in ABCB5+ malignant melanoma-initiating cells by promoting the expression of SOCS1.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24300535 2014 The multidrug-resistance transporter ABCB5 is expressed in human placenta.
23770371 2013 Genetically determined ABCB5 functionality correlates with pigmentation phenotype and melanoma risk.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23259602 2012 Genome-wide association scan of dental caries in the permanent dentition.
22865455 2012 CD133+ melanoma subpopulations contribute to perivascular niche morphogenesis and tumorigenicity through vasculogenic mimicry.
22784549 2012 ABCB5 expression and cancer stem cell hypothesis in oral squamous cell carcinoma.
22675422 2012 Melanoma chemotherapy leads to the selection of ABCB5-expressing cells.
22555176 2012 Profiling of ABC transporters ABCB5, ABCF2 and nestin-positive stem cells in nevi, in situ and invasive melanoma.
22393060 2012 The helicase HAGE expressed by malignant melanoma-initiating cells is required for tumor cell proliferation in vivo.
22306008 2012 Expression of human ABCB5 confers resistance to taxanes and anthracyclines.
22044138 2012 Expression of ABCB5 gene in hematological malignances and its significance.
21652540 2011 ABCB5 identifies a therapy-refractory tumor cell population in colorectal cancer patients.
21298007 2011 Molecular evolutionary analysis of ABCB5: the ancestral gene is a full transporter with potentially deleterious single nucleotide polymorphisms.
21212411 2011 VEGFR-1 expressed by malignant melanoma-initiating cells is required for tumor growth.
20950786 2010 A genome-wide study reveals copy number variants exclusive to childhood obesity cases.
20729912 2010 Tenascin-C promotes melanoma progression by maintaining the ABCB5-positive side population.
20682318 2011 Granulin-epithelin precursor and ATP-dependent binding cassette (ABC)B5 regulate liver cancer cell chemoresistance.
20339536 2010 Genome-wide association of lipid-lowering response to statins in combined study populations.
20068175 2010 Modulation of T-cell activation by malignant melanoma initiating cells.
19477512 2009 ABCB5 gene amplification in human leukemia cells.
18772397 2008 Core signaling pathways in human pancreatic cancers revealed by global genomic analyses.
18202660 2008 Identification of cells initiating human melanomas.
17661346 2008 The Role of heat shock protein 27 in extravillous trophoblast differentiation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15899824 2005 ABCB5-mediated doxorubicin transport and chemoresistance in human malignant melanoma.
15760339 2005 Principal expression of two mRNA isoforms (ABCB 5alpha and ABCB 5beta ) of the ATP-binding cassette transporter gene ABCB 5 in melanoma cells and melanocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15205344 2004 Membrane transporters and channels: role of the transportome in cancer chemosensitivity and chemoresistance.
12960149 2003 Regulation of progenitor cell fusion by ABCB5 P-glycoprotein, a novel human ATP-binding cassette transporter.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8894702 1996 Characterization of the human ABC superfamily: isolation and mapping of 21 new genes using the expressed sequence tags database.