Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.20
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
acute quadriplegic myopathy -1.644 2.3e-08
cutaneous lupus erythematosus -1.100 2.0e-03
ductal carcinoma in situ -1.100 7.4e-04
interstitial cystitis -1.100 2.1e-03
intraductal papillary-mucinous adenoma (... 2.100 3.0e-04
invasive ductal carcinoma -1.100 2.3e-02
juvenile dermatomyositis -1.042 1.8e-10
lung adenocarcinoma -1.039 2.0e-04
malignant mesothelioma -1.800 3.2e-07
ovarian cancer -1.800 2.0e-07
psoriasis -1.800 2.2e-04
subependymal giant cell astrocytoma 1.313 3.7e-03
ulcerative colitis -1.100 1.3e-06

Gene RIF (1)

AA Sequence

MTSPEIASLSWGQMKVKGSNTTYKDCKVWPGGSRTWDWRETGTEHSPGVQPADVKEVVEKGVQTLVIGRG      1 - 70
MSEALKVPSSTVEYLKKHGIDVRVLQTEQAVKEYNALVAQGVRVGGVFHSTC                       71 - 122
//

Text Mined References (10)

PMID Year Title