Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Synonym

Accession A8MYZ0
Symbols C3orf76
FAM188B2

Gene

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MATKLRQILFGNTVHVFSYNWKKAYFRFHDPSSELAFTLEVGKGGARSIQMAVQGSIIKYLLFTRKGKDC      1 - 70
NLGNLCEISKKEQEQALAAALAGILWAAGAAQKATICLVTEDIYVASTPDYSVDNFTERLQLFEFLEKEA     71 - 140
AEKFIYDHLLCFRGEGSHGVILFLYSLIFSRTFERLQMDLDVTTTQLLQPNAGGFLCRQAVLNMILTGRA    141 - 210
SPNVFNGCEEGKSQETLHGVLTRSDVGYLQWGKDASEDDRLSQVGSMLKTPKLPIWLCNINGNYSILFCT    211 - 280
NRQLLSDWKMERLFDLYFYSGQPSQKKLVRLTIDTHSHHWERDQQEEKHGPRRRFSPVEMAIRTKWSEAT    281 - 350
INWNGTVPFF                                                                351 - 360
//

Text Mined References (3)

PMID Year Title