Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A8MYA2
Symbols CXorf49

Gene

 Compartment GO Term (0)

AA Sequence

MSSPDKVSVCGAGFDLEGGKKAGSRTASPGAPGAHSHGLDLGVPGSGDGKSESGFTDPEGFSFESESELI      1 - 70
EQGRVVLWGREGRPGTPVDDQGDVVDYSFYLADEPAAIVPPPSVQGHPFPEGAAAEGSAENWADAEVGPS     71 - 140
GRDVLGHSPGKWQQASAGRLHLCGPGPVRAWKNPERGSKSRWSLRVDPQQPSAKGPTRLPTHDSDSADES    141 - 210
SDLPLMKVGICRNEGSQAKPGSPKKRADTSRQASFHCKESYLPVPGRFLTSAPRGLTPVAERPAVGELED    211 - 280
SPQKKMQSRAWGKVEVRPSCSGAAAAGALPQGLSRRKMAGGKKSLGGASQLALGRGFPACGERLSAAPPE    281 - 350
PATFPPFSGVRPQGMSKKPQKPKHSSPGKKPAGRKTRESQAAAREDNDPNRDEVPRAQLPTHRPGLPRLS    351 - 420
VRRGEFSSSDPNIRAPQLPGTSEPSAYSPGGLVPRRHAPSGNQQPPVHPPRPERQQQPPGAQGCPRCIWL    421 - 490
QREIEDLTQQLAAMQFLTDKFQDL                                                  491 - 514
//

Text Mined References (2)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).