Knowledge Summary

Patent

No data available

AA Sequence

MQVTFCRLRTHQWCFILFNVILFHALLFGTDFVEEYFLHSLPYIDVKVLEIKNKARKLNIEPLRSNLSKY      1 - 70
YVLSQSEICKGKNIFLLSLIFSSPGNGTRRDLIRKTWGNVTSVQGHPILTLFALGMPVSVTTQKEINKES     71 - 140
CKNNDIIEGIFLDSSENQTLKIIAMIQWAVAFCPNALFILKVDEETFVNLPSLVDYLLNLKEHLEDIYVG    141 - 210
RVLHQVTPNRDPQNRDFVPLSEYPEKYYPDYCSGEAFIMSQDVARMMYVVFKEVPMMVPADVFVGICAKF    211 - 280
IGLIPIHSSRFSGKRHIRYNRCCYKFIFTSSEIADPEMPLAWKEINDGKECTLFETSYELISCKLLTYLD    281 - 350
SFKRFHMGTIKNNLMYFAD                                                       351 - 369
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.