Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A8MWX3
Symbols FAM39CP
CXYorf1P

Gene

 GO Function (1)

AA Sequence

MSGVMCLKASDTWASGIRSQPQGCLGKWRSMRCKHTRMHLAHLGNSRQLISLGPPRTREDGSRISQQVEQ      1 - 70
SRSQVQAIGEKVSLAQAKIEKIKGSKKAIKVFSSAKYPAPERLQEYGSIFTDAQDPGLQRRPRHRIQSKQ     71 - 140
RPLDERALQEKLKDFPVCVSTKPEPEDDAEEGLGGLPSNISSVSSLLLFNTTENLYKKYVFLDPLAGAVT    141 - 210
KTHVMLGAETEEKLFDAPLSISKREQLEQQVPENYFYVPDLGQVPEIDVPSYLPDLPGIANDLMYIADLG    211 - 280
PGIAPSAPGTIPELPTFHTEVAEPLKVDLQDGVLTPPPPPPPPPPAPEVLASAPPLPPSTAAPVGQGARQ    281 - 350
DDSSSSASPSVQGAPREVVDPSGGWATLLESIRQAGGIGKAKLRSMKERKLEKQQQKEQEQVRATSQGGH    351 - 420
LMSDLFNKLVMRRKGISGKGPGAGDGPGGAFARVSDSIPPLPPPQQPQAEDEDDWES                 421 - 477
//

Text Mined References (6)

PMID Year Title
18159949 2007 Human subtelomeric WASH genes encode a new subclass of the WASP family.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
11701968 2001 Characterization of the murine orthologue of a novel human subtelomeric multigene family.
10655549 2000 Differentially regulated and evolved genes in the fully sequenced Xq/Yq pseudoautosomal region.
9054936 1997 The relationship between chromosome structure and function at a human telomeric region.