Property Summary

NCBI Gene PubMed Count 39
PubMed Score 0.00
PubTator Score 2.39

Knowledge Summary

Patent

No data available

Gene RIF (37)

PMID Text
23952617 Array CGH showed a 95 Kb de novo duplication on chromosome 19q13.4 encompassing four killer cell immunoglobulin-like receptor (KIR) genes.
20878400 Observational study of gene-disease association. (HuGE Navigator)
20670355 Observational study of genotype prevalence. (HuGE Navigator)
20652381 Observational study of gene-disease association. (HuGE Navigator)
20650299 Observational study of genotype prevalence. (HuGE Navigator)
20600442 Observational study of gene-disease association. (HuGE Navigator)
20492596 Observational study of gene-disease association. (HuGE Navigator)
20426625 Observational study of gene-disease association. (HuGE Navigator)
20210918 Observational study of genotype prevalence. (HuGE Navigator)
20200544 Observational study of genotype prevalence. (HuGE Navigator)
More...

AA Sequence

MSLMVISMACVGFFLLQGAWTHEGGQDKPFLSAWPSPVVSEGEHVALQCRSRLGFNEFSLSKEDGMPVPE      1 - 70
LYNRVFRNTVFIGPVTPAHAGTYRCRGSHPHFLTGWSAPSNPLVIMVTGVHRKPSLLAHPGPLVKSEETV     71 - 140
ILQCWSDVMFEHFLLHREGKFNDTLRLTGELHDGVSKANFSIGRMTQDLAGTYRCYGSVPHSPYQLSAPS    141 - 210
DPLDIVITGLCGKPSLSAQPRPMVKAGESVTLSCSSRSSYDIYHLSREGEAHELRFPAVPKVNGTFQANF    211 - 280
PLGPATHGGTYRCFGSFRDSPYEWSDLSDPLLVSVTDSMKEKGKDVIL                          281 - 328
//

Text Mined References (39)

PMID Year Title
23952617 2015 Partial duplication of chromosome 19 associated with syndromic duane retraction syndrome.
20878400 2010 Association of KIR2DS1 and KIR2DS3 with fatal outcome in Ebola virus infection.
20670355 2010 Diversity of killer cell immunoglobulin-like receptor genes in Indonesian populations of Sumatra, Sulawesi and Moluccas Islands.
20652381 2010 Polymorphisms of KIR gene and HLA-C alleles: possible association with susceptibility to HLA-B27-positive patients with ankylosing spondylitis.
20650299 2010 Killer cell immunoglobulin-like receptor gene diversity in the Tibetan ethnic minority group of China.
20600442 2010 Associations between genes for killer immunoglobulin-like receptors and their ligands in patients with solid tumors.
20492596 2010 Distribution of KIR genes in the population of unrelated individuals homozygous for ancestral haplotype AH8.1 (HLA-A1B8DR3).
20426625 HLA and KIR frequencies in Sicilian Centenarians.
20210918 2010 Distribution of killer cell immunoglobulin-like receptor genes in the mestizo population from Venezuela.
20200544 2010 Signatures of natural selection and coevolution between killer cell immunoglobulin-like receptors (KIR) and HLA class I genes.
More...