Property Summary

NCBI Gene PubMed Count 39
PubMed Score 0.00
PubTator Score 2.39

Knowledge Summary

Patent

No data available

Gene RIF (37)

AA Sequence

MSLMVISMACVGFFLLQGAWTHEGGQDKPFLSAWPSPVVSEGEHVALQCRSRLGFNEFSLSKEDGMPVPE      1 - 70
LYNRVFRNTVFIGPVTPAHAGTYRCRGSHPHFLTGWSAPSNPLVIMVTGVHRKPSLLAHPGPLVKSEETV     71 - 140
ILQCWSDVMFEHFLLHREGKFNDTLRLTGELHDGVSKANFSIGRMTQDLAGTYRCYGSVPHSPYQLSAPS    141 - 210
DPLDIVITGLCGKPSLSAQPRPMVKAGESVTLSCSSRSSYDIYHLSREGEAHELRFPAVPKVNGTFQANF    211 - 280
PLGPATHGGTYRCFGSFRDSPYEWSDLSDPLLVSVTDSMKEKGKDVIL                          281 - 328
//

Text Mined References (39)

PMID Year Title