Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A8MWA6
Symbols FAM90A22

 Compartment GO Term (1)

AA Sequence

MMARRDPKSWAKRLVRAQTLQKQRRARVGPRAPPPDEEDPRLKCKNCGAFGHTARSTRCPMKCWKAALVP      1 - 70
ATLGKKEGKENLKPWKPRAEANPGPLNKDKGEKEERPRQQDPQRKALLHMFSGKPPEKPLPNGKGSTESS     71 - 140
DYLRVASGPMPVHTTSKRPRLDPVLADRSATEMSGRGSVLASLSPLRKTSLSSSSSLGPKERQTGAAADM    141 - 210
PQPAVRHQGPEPLLEVKPTHSRPEGGCQEVPQAASKTHGLLQASRPQAQDKRPAVTPQPCPPAATHSLGL    211 - 280
GSNLSFGPGAKKPAQAPIQACLNFPKKPRLGPFQIPESAIQGGELGAPENLQPPPAATELGPSTSPQMGR    281 - 350
RTPAQVPSVDRQPPHSRPCLPTAQACTMSHHSAAGHDGAQPLRVLFRRLENGRWSSSLLAAPSFHSPEKP    351 - 420
GAFLAQSPHVSEKSEAPCVRVPPSVLYEDLQVSSSSEDSDSDLE                              421 - 464
//

Text Mined References (3)

PMID Year Title