Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.17

Knowledge Summary


No data available


AA Sequence

DETIFQLSDAFPLFTFYLWRVGILLSSAQIETLRK                                       351 - 385

Publication (3)

PMID Year Title
24710101 2010 Initiation of meiotic recombination in mammals.
20551173 2010 Functional conservation of Mei4 for meiotic DNA double-strand break formation from yeasts to mice.
14574404 2003 The DNA sequence and analysis of human chromosome 6.