Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MDVQKWYLRTSKLALALAIIRSKPADKSSREYTEHLAMLLSEEQSKWRSKVEILEAEVMQLRQKLLVSRL      1 - 70
CSGSFKSGYVSSQLEAQEPKSSESTLTSMEDSGCDLSNEQRTESSDLSQHFVESCTPTHFPPLPLVKRPC     71 - 140
AILQNPLSSHMQFLQYLLELKNLTESGNLKRDLTHFEKDSSTVSDSVFQLLDGLITFYRNPKLPFSRFWT    141 - 210
EAVGTLASLISDYNLSSHILKKCSKKLEEFEKTLLHAILGNNHINQFQVQHYVSQSLVTLGNCSLLRKSI    211 - 280
ISLLLSEVNGFADDLGAINQEQASYDVSRYENIFYLFWVLEQLLQKETEEGNTSSIGHDDQEIKKFLQKH    281 - 350
DETIFQLSDAFPLFTFYLWRVGILLSSAQIETLRK                                       351 - 385
//

Text Mined References (3)

PMID Year Title